KEGG   Mus musculus (mouse): 217265Help
Entry
217265            CDS       T01002                                 

Gene name
Abca5, ABC13, B930033A02Rik, mKIAA1888
Definition
(RefSeq) ATP-binding cassette, sub-family A (ABC1), member 5
  KO
K05648  ATP-binding cassette, subfamily A (ABC1), member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    217265 (Abca5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    217265 (Abca5)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCA (ABC1) subfamily
   ABCA5, 6, 8, 9, 10 subgroups
    217265 (Abca5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 RsgA_GTPase AAA_29 MMR_HSR1 AAA_16 AAA_23 DUF4162 Dynamin_N cobW
Motif
Other DBs
NCBI-GeneID: 217265
NCBI-ProteinID: NP_671752
MGI: 2386607
Ensembl: ENSMUSG00000018800
Vega: OTTMUSG00000003326
UniProt: Q8K448
Position
11; 11 E1
AA seq 1642 aa AA seqDB search
MATAIRDVGVWRQTRTLLLKNYLIKCRTKKSSVQEILFPLFFLFWLILVSMMHPNKKYEE
VSDIELSPMDKFSLSNVILGYTPVTNITSSIMQRVSTDHLPKVIVTEEYANEKELVAASL
SKSSNFVGVVFKDTMSYELRFFPEMIPVSSIYMNSREGCSKTCDAAQYWSLGFTVLQASI
DAAIIQLKTNVSVWSELESTKAVIMGEAAVVEIDTFPRGVILIYLVIAFSPFGYFLAIHI
VAEKEKKLKEFLKIMGLHDTAFWLSWVLLYASLIFLMSLLMAVIATASSLFPQSSSIVIF
LLFFLYGLSSVFFALMLTPLFKKSKHVGVVEFFVTVVFGFVGLLIVLIESFPRSLVWLFS
PLCQCAFLIGIAQVMHLEDFNEGALFSNLTEGPYPLIITIIMLALDSVFYVLLAVYLDQV
IPGEFGLRRSSLYFLKPSYWSKNKRNYKELSEGNINGNISLNEIVEPVSSEFIGKEAIRI
SGIQKSYRKKTENVEALRNLSFDIYEGQITALLGHSGTGKSTLMNILCGLCPPSDGFASI
YGHRVSEIDEMFEARKMIGICPQSDINFDVLTVEENLSILASIKGIPANNIIQEVQKVLL
DLDMQAIKDNQAKKLSGGQKRKLSVGIAVLGNPKILLLDEPTAGMDPCSRHIVWNLLKYR
KANRVTVFSTHFMDEADILADRKAVISQGMLKCVGSSIFLKSKWGIGYRLSMYIDRYCAT
ESLSSLVRQHIPAAALLQQNDQQLVYSLPFKDMDKFSGLFSALDIHSNLGVISYGVSMTT
LEDVFLKLEVEAEIDQADYSVFTQQPREEETDSKSFDEMEQSLLILSETKASSVSTMSLW
KQQVSTIAKFHFLSLKRESKSVRAVLLLLLIFFAVQIFMFFLHHSFKNAVVPIKLVPDLY
FLKPGDKPHKYKTSLLLQNSTDSDINGLIEFFAHQNIMVAMFNDSDYVSAAPHSAALNVV
RSEKDYVFSAVFNSTMVYCLPVMMNIISNYYLYHLNVTEAIQTWSTPFIQEITDIVFKIE
LYFQAALLGIIVTAMPPYFAMENAENHKIKAYTQLKLSGLLPSAYWVGQAVVDIPLFFVV
LILMLGSLFAFHHGLYFYPAKFLAVVFCLIAYVPSVILFTYIASFTFKKILNTKEFWSFI
YSVTALACVAITETTFFLQYAVTAVFHYTFCIAIPIYPLLGCLISFIKGSWKNMPKNENT
YNPWDRLLVAVIMPYLQCILWIFLLQHYEKIHGGRSIRKDPFFRALSQKAKNKKFPEPPI
NEDEDEDVKAERLKVKELMGCQCCEEKPAIMVCNLHKEYDDKKDFLHSRKTTKVATKYIS
FCVKKGEILGLLGPNGAGKSTVINTLVGDVEPTSGKIFLGDYGSHSSEDDESIKCMGYCP
QTNPLWPDLTLQEHFEIYGAVKGMSPGDMKEVISRITKALDLKEHLQKTVKKLPAGIKRK
LCFALSMLGNPQVTLLDEPSTGMDPRAKQHMWRAIRTAFKNKKRAALLTTHYMEEAEAVC
DRVAIMVSGQLRCIGTVQHLKSKFGKGYFLEIKLKDWIENLEIDRLQREIQYIFPNASRQ
ESFSSILAFKIPKEDVQSLSQSFAKLEEAKRTFAIEEYSFSQATLEQVFVELTKEQEEED
NSCGTLASTLWWERTQEDRVVF
NT seq 4929 nt NT seq  +upstreamnt  +downstreamnt
atggctactgcaattagggatgtgggagtttggagacagaccagaacacttctactgaaa
aattacctaattaaatgcaggactaaaaaaagtagtgttcaggaaattctttttcctcta
tttttcttattttggctgatattagttagcatgatgcatccaaataagaaatatgaagag
gtatctgatatagagctcagccctatggacaaattcagcctttccaacgttattcttgga
tacactcccgtgactaacattacaagcagcattatgcagagggtttctaccgatcatctt
cccaaggttatagttactgaagaatacgcaaatgagaaagaactggtagccgcaagtctt
tctaagtccagcaacttcgtaggtgtggttttcaaagacaccatgtcctatgaacttcgt
ttttttcctgaaatgattccagtgtcttctatttatatgaattcaagagaaggctgttca
aagacatgtgatgctgctcagtactggtctttggggtttacagttctgcaggcatcgata
gatgctgccattatacagctgaagaccaatgtttctgtgtggagcgagctggagtcgacc
aaagctgtgatcatgggagaggccgctgttgtggagattgacaccttcccgcgaggggtc
atcctcatctacctcgtcatagccttctcgcccttcggctacttcctggcaatccacatc
gtggcagaaaaagaaaagaagttaaaggaatttttaaagataatgggacttcatgacact
gctttttggctttcctgggttcttctgtacgcaagcttgattttccttatgtccctgctt
atggctgtcatcgcaacagcttcttcgttattccctcagagtagcagcattgtgatcttt
ctactgttcttcttatatggattgtcatctgtgttttttgctttaatgctgacgcctctt
tttaaaaaatcaaaacacgtgggagtcgttgagttttttgtcaccgtggtgtttggattt
gttggcctgctgattgtcctcatagaaagtttccccaggtcgctggtgtggctcttcagt
cctttgtgtcagtgtgcctttctgattgggattgcacaggtcatgcatttagaagatttt
aatgagggtgccttattttctaatttgactgaaggtccctatcctctaattattactatt
atcatgctagctcttgacagtgtgttctatgtcctcctggctgtgtatctcgaccaagtc
attccaggggaatttggcttgaggaggtcatctttgtattttttgaagccatcgtattgg
tcaaaaaacaaaagaaactataaggagctatcggagggcaacattaatggcaatattagt
ctcaatgaaattgttgagcccgtttcttcagaatttatagggaaagaagctataagaata
agtggtattcagaaatcctatagaaagaaaactgagaacgtggaggctttgagaaatttg
tcatttgacatatatgaaggtcagattactgcactgctgggccacagtggaacaggaaaa
agcacactgatgaatattctgtgtggactgtgtccaccctctgatgggtttgcttctata
tatggacacagagtctctgaaatagatgaaatgtttgaagcaagaaaaatgattggcata
tgtccgcagtcagatataaactttgatgttctgacagtagaagaaaatttatcaattttg
gcttcaatcaaaggaataccagccaacaatataattcaagaagtgcagaaagtgttgctg
gatctggacatgcaagccatcaaagataatcaagcgaaaaagttaagcggtggtcagaaa
aggaagctgtctgtaggaattgcagttctcgggaatccaaagatactcctgctagacgag
cctacagcaggaatggacccctgctctcgccatattgtttggaatcttctaaagtataga
aaggctaacagagtgaccgtgtttagtactcacttcatggatgaggctgacattcttgcc
gacaggaaagctgtcatatcacaaggaatgctgaagtgtgttggttcttcaattttccta
aagagtaaatggggaatcggctaccgcctgagcatgtatatagacagatactgtgccaca
gagtcactgtcgtcgctggttaggcagcacatacccgcagccgcgctactgcagcagaat
gaccagcagctcgtgtacagcctgcctttcaaagacatggacaaattttcaggcttgttt
tctgctctagacattcattcaaacctgggtgttatttcttatggtgtttccatgacaaca
ttggaagatgtattcttaaagctagaagttgaagcagaaattgaccaagcagactatagt
gtatttacacagcagccgcgggaggaagaaacagattcaaaatcctttgatgaaatggaa
cagagtttacttattctctctgaaacgaaagcttcttcagtgagcaccatgagcctctgg
aagcagcaagtgtctacgattgcaaagtttcatttcctctcattgaaacgagaaagcaaa
tcagtgcgcgctgtgttgcttctgcttttaattttttttgcagttcagatttttatgttt
tttctccatcattcttttaaaaatgctgtggttcccatcaaactcgttccagacttgtat
ttcctaaagcctggagataaacctcataaatacaaaacaagcctgctgcttcaaaattct
actgactcagatatcaatggtcttattgagttttttgcacaccagaacataatggtggca
atgtttaatgacagtgactatgtgtctgctgctcctcacagtgcggctctcaatgtggtg
cgttctgaaaaggactatgttttttctgctgttttcaacagtactatggtttattgtttg
ccagtcatgatgaacatcattagtaactactatctttatcatttaaatgtgactgaagcc
atccagacctggagtaccccgttcattcaagaaattactgacattgtttttaaaattgag
ctatattttcaagcagctttgcttggaatcattgttactgcaatgccaccttactttgcc
atggaaaatgcagagaatcataagatcaaagcttatactcaacttaaactttcgggtctt
ttgccatcagcctattgggttggacaagctgttgtggatattcccttgttttttgttgtt
ctgattttgatgctgggaagtttatttgcatttcatcatggactgtatttttatcctgca
aaatttcttgctgtggtgttttgcctcattgcttatgtgccctccgtcattctgttcacg
tacatagcttcgttcactttcaagaaaattttaaataccaaggaattttggtcatttatc
tattctgtgaccgcattggcttgtgtggcaatcacggaaacaactttctttctgcaatat
gcagttacggctgtctttcattacaccttctgcatagccattccaatctaccctctcctg
ggttgtctgatttctttcataaagggttcttggaagaatatgccaaaaaatgagaatacc
tacaatccctgggatagacttttagttgctgtaatcatgccctacctgcagtgtatactg
tggattttcctcttacaacactatgagaaaatacatggaggcagatctataagaaaggat
ccatttttcagggccctttcacaaaaggccaaaaataagaagtttccagaaccacccatc
aatgaggatgaagatgaagatgtcaaagctgaaagactgaaggttaaagagctgatgggt
tgccagtgttgtgaggagaagccagccattatggtatgcaatttgcataaagagtatgat
gacaagaaagattttcttcattcaagaaaaacaacaaaagtagcaacaaaatacatctct
ttctgtgtgaaaaaaggagagatcttgggactgttgggtccaaatggagctggcaaaagc
acagtcattaacactctggttggggacgttgagccaacttcaggcaagatctttctagga
gattatggttcacattcaagtgaagatgacgaatccattaagtgtatggggtactgcccc
cagacaaacccactgtggccagatctcactctacaggaacattttgagatttacggagct
gtgaaaggaatgagtcctggtgacatgaaggaagtcatcagtcgaataacaaaagccctt
gatttgaaagaacatcttcagaagactgtaaagaagctacctgcagggatcaagcgaaag
ctgtgttttgctctcagcatgctggggaaccctcaggtgacgctgctggatgagccgtcc
acaggcatggacccaagagccaagcagcacatgtggagagctattcgaactgcatttaaa
aacaaaaagcgggccgccctcctgactactcattacatggaagaggcagaggctgtctgt
gacagagtggccatcatggtatctgggcagctaagatgtattggaacagtacaacatcta
aagagtaagtttggtaaaggctactttttggaaattaaattaaaggactggatagaaaac
ctggaaatagatcgccttcaaagagaaattcaatatattttcccaaatgcaagccgccaa
gagagcttttcttctattttggcttttaaaattccaaaagaagatgttcagtctctctca
caatccttcgctaagttggaagaagcaaaacgcacttttgccattgaagaatacagcttt
tctcaagcaaccctggaacaggtttttgtagaacttactaaagagcaagaggaagaagat
aacagctgtgggactttggccagcactctctggtgggaaaggacgcaggaggatagagta
gtattttga

DBGET integrated database retrieval system