KEGG   Mus musculus (house mouse): 217325
Entry
217325            CDS       T01002                                 
Symbol
Llgl2, 9130006H11Rik, Llglh2
Name
(RefSeq) LLGL2 scribble cell polarity complex component
  KO
K06094  lethal(2) giant larvae protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    217325 (Llgl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    217325 (Llgl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    217325 (Llgl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    217325 (Llgl2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    217325 (Llgl2)
SSDB
Motif
Pfam: LLGL WD40
Other DBs
NCBI-GeneID: 217325
NCBI-ProteinID: NP_663413
MGI: 1918843
Ensembl: ENSMUSG00000020782
UniProt: Q3TJ91 Q8BVC8
Position
11:115714855..115746606
AA seq 1027 aa
MRRFLRTGHDPARERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAVKLYG
APGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFTLR
GPPGAAPSATQVTEILPHSSGELLYLGTESGNVFVVQLPGFRTLHDRTICSDEVLQWLPE
EARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRALSHFLSSQQLENASWQR
DGCLIVTCHSDGSHCQWPVSSDTQNPEPLRSSIPYGPFPCKAITKIFWLTTRQGLPFTIF
QGGMPRASYGDRHCISVVHNGQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEE
LVVIDLQTPGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNSHFSTMEW
PIDGGTSLAPPPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPSENLI
AQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEH
AVEQVEADLLQDQEGYRWKGHERLAARPGPVCFEAGFQPFVLVQCQPPAVVTSLALHSEW
RLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRS
RVSSHKRRPGGPTGEAQAQAVNIKAERTGLQNMELAPVQRKIEARSAEDSFTGFVRTLYF
ADTYLRDSSRHCPSLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVG
ILVLDGHNVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTAL
EGSRVRRVGVAHFGSCRAEDYGEHHLAVLTNLGDIQVVSMPLLKPQVRYSCIRREDVSGI
ASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSTKAKKHNRPSNGNGTGLKMTS
SGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTLEGDRRSYGNWHPHRVAVGCR
LSNGEAE
NT seq 3084 nt   +upstreamnt  +downstreamnt
atgaggcggttcctgagaactggacatgaccctgcccgggagaggctgaagcgggatctg
ttccagtttaacaagacagtggagcatggcttcccacaccagcccagcgcccttggctat
agcccttcgctgcgcatcctggccatcggaacccgctctggagctgtcaagctatatggc
gcccccggggtagagttcatgggccttcacaaggagaacaacgcagtgctgcagatccac
ttcctgcctggtcagtgtcagctggtcactctgctggatgacaatagcctgcacctgtgg
agcctgaaggtcaagggcggggtgtcagagctgcaggaagaagagagcttcacattgcgt
ggccccccaggggctgcccccagtgccacgcaggtcactgagattctacctcactcttcc
ggagaactgctctacctgggcaccgagagcggcaacgtgtttgtggtgcagctcccgggg
ttccgcacgctgcacgacaggaccatctgttcagatgaggtgctgcaatggttgccagag
gaggctcgccaccggcgagtgtttgagatggtggaggctctgcaggagcaccctcgagac
cccaaccaaatcctcattggctacagccgaggcctcgtcgtcatctgggaccttcagggc
agccgagcgctcagtcatttcctcagcagccagcaactggagaatgccagctggcagcgg
gatggctgcctgattgtcacctgccactccgacggcagccactgccagtggcccgtctcc
agtgacacccagaacccagaacctctgcgcagctctataccttacggtccctttccttgc
aaagctataacgaaaatcttctggctcaccaccaggcaagggttgcccttcaccatcttc
cagggcggtatgccacgggccagctatggggaccgccactgcatctcagtggtccacaac
ggccagcagacggccttcgacttcacctcccgtgtcattgacttcactgttctctcagag
gctgaccctgcggctgcctttgatgacccctacgccctggtggtgctagccgaggaggaa
ctggtagtcattgacctgcagacacccggctggccaccagtccagctgccctacctggct
tccttgcactgttccgctatcacctgctcccaccacgtctccaacatccccctgaagcta
tgggaacgcatcatcgccgcgggcagccgccagaactcacacttctccaccatggagtgg
cccatagatggtggcaccagcctggccccaccgccaccccagagggacctgctgctcaca
gggcacgaggacggcacggtgcggttctgggacgcctccggtgtgtgcttacgtctgctc
tacaaactgagcactgtgagggtgttcctcacagacacggaccccagcgagaacctcatt
gcccagggtgaggacgagtggcccccactccgcaaggtgggctcctttgatccctacagc
gatgatccgcggctaggcatccagaagattttcctctgcaaatacagcggctacctggct
gtggcaggcacggcagggcaggtgctggtgctggagttgaacgatgaggcggccgagcat
gctgtggagcaggtggaggctgacctgctgcaggaccaggagggttaccgctggaagggg
cacgagcgcctcgccgcccgcccggggcccgtgtgctttgaggcgggatttcagcccttt
gtactggtgcagtgccagcccccagctgtggtcacctccttggctctgcactccgagtgg
cggcttgtggcctttggcaccagccatggtttcggcctcttcgatcaccagcaacggcgg
caggtctttgtcaagtgcacacttcaccccagtgaccagctggccttggagggccctctg
tctcgagtaaagtccctcaagaagtctctacgtcagtcattccgtcggatgcgtcgcagc
agagtgtccagtcataaacggcggcctggtggccccacaggcgaggcgcaggcccaggct
gtgaatatcaaggctgagcggacgggcctgcagaacatggagttggcgcccgtgcaacgg
aagattgaggctcgctccgcggaggactccttcactggctttgtccggaccctctatttc
gctgatacctacctgagggacagttcccgccactgtccctccctgtgggctggcaccaac
ggaggcaccgtctacgccttttccctgcgcgtgcctcctgcagaaagaagaacagatgaa
cctgtccgggcagagcaggccaaggagatccagctgatgcatcgcgcgcctgtggtgggc
atcctggtgctcgacggacacaacgtgcccctccccgagcccctggaagtcgcccatgac
ctgtcgaagagcccagacatgcaagggagccaccaattgcttgtggtgtcggaggagcaa
ttcaaggtattcacactgcccaaggtgagcgccaaactgaagctgaagctgacggccctg
gagggctcacgggtgcggcgagtcggtgtcgcccactttggcagctgcagggctgaggac
tatggggagcaccacctggcagtgctcaccaacttgggtgacatccaggtggtctcaatg
cccctgctcaagccccaggtgcggtacagctgcatccgccgggaggacgtcagcggcata
gcttcctgtgtcttcaccaaatatggccaaggtttctatctgatatcaccttcggagttc
gagcgcttttctctctccaccaagtggctggttgaaccccggtgtttggtggattcaacc
aaagccaagaagcacaaccggcccagcaatggcaatggcacaggcctcaaaatgacctcc
tcaggccacgtcaggaactcaaagagccaaagtgatggagatgagaagaagccgggccca
gtgatggagcacgcgctgctcaatgacgcctgggtcctaaaggaaatccagagcacgctg
gagggggaccggaggagctatggcaattggcatcctcaccgcgtggctgtgggttgcagg
ctcagcaatggagaagcagaatga

DBGET integrated database retrieval system