KEGG   Mus musculus (mouse): 217356
Entry
217356            CDS       T01002                                 

Symbol
Tmc8, EVIN2, Ever2, mFLJ00400
Name
(RefSeq) transmembrane channel-like gene family 8
  KO
K21988  transmembrane channel-like protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    217356 (Tmc8)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   217356 (Tmc8)
SSDB
Motif
Pfam: TMC DUF1514
Other DBs
NCBI-GeneID: 217356
NCBI-ProteinID: NP_001182019
MGI: 2669037
Ensembl: ENSMUSG00000050106
Vega: OTTMUSG00000003679
UniProt: Q7TN58 B0QZP7
Position
11; 11 E2
AA seq 722 aa
MFRQWSVQSGPAPRRPESQAASEELWEQEVERLCASRTPVRMLPYAMADKRFIRELREPE
GVKTTFWQRWHRPRRVARQHLREAEQRLARGFGLWEGALYEIGGLFGTGIQSYFTFLRFL
LLLNLLTMLLTACFVLLPLVWLRPPELGPALKLRLQCSSSPLPQSDIPRFHNPLWNILTG
RAFNNTYLFYGAYRAGPESSSEYSIRLAYLLSPMVCLLLCFCGILQRMAEGLPQQTLLGQ
RYRTPLSAKVFSSWDFCIRVWEAATIKKHEISNELKVCLEEGRRVELAQQQTRAQKACRL
LTYLRTNILIVLLVVGAISAIFWATKYSQDNKEESLFLVLQYLPPGVISLVNFLGPQLFT
VLIQLENYPPGTEVNLTLIWCVVLKLASLGMFSFSLGQTVLCIGRNKTSCESYGYNACDY
QCWENSVGEELYKLIIFNFLLTVAFAFLVSLPRRLLVERFSGWFWTWLDREEFLVPKNVL
DIVAAQTVTWMGLFYCPLLPLLNSVFLFLTFYIKKYTLLRNSRASPRRFRASSSTFFFHL
VLLLGLLLAAVPLAYVISSTHSSWDCGLFTNYSAPWQVVPELVALQLPLPSQRALRYLSS
HAFSFPLLILLSIVLTVCISQSRANARAIQGLRKQLVWQVQEKWHLVDDLSRLLPELSPE
PGSPHSRASRPRSFCPGFPCPGSPGPRTPRLAPSNRLSSSSLGAPSASVPASRFHFPSRT
EL
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgtttcgccagtggtcggtgcagtcaggaccagccccacgaaggcctgaatcccaggcg
gcctcggaggagctgtgggagcaagaagtggagcggctatgcgcctcccggacgcctgtg
cggatgctgccttacgccatggcagacaagcgcttcatccgggaactgcgggagcccgag
ggagtgaagaccaccttctggcagcggtggcatcgcccgaggcgggtggcgcgacaacac
ctgagggaggcagagcaacggctggcccgcggcttcggtctctgggagggagctctctac
gagattgggggcctcttcggaaccgggatccagtcctacttcactttccttcgcttcctg
ctgctgctcaacctgctgaccatgctgctgactgcctgctttgtgctgctgcccctggtc
tggctccgcccccctgagctaggccctgccctgaaactgagactccagtgctccagcagc
cccctgcctcagagtgacattccaaggtttcacaacccactttggaatattttaacgggc
agagccttcaacaacacctatctcttctacggtgcctaccgagcggggccagagagcagc
tctgaatacagcatccgcctggcctacctccttagcccgatggtctgcctgctcctctgt
ttctgtgggatactgcagaggatggcagaaggcctaccccagcagacactcttgggtcag
cgctacaggacacccctcagcgccaaagtgttctcatcctgggacttctgcatccgggtg
tgggaagccgccaccatcaagaagcacgaaatcagcaatgaactgaaggtgtgtctggaa
gagggccgccgcgtggagctggctcaacaacagaccagggcccagaaggcctgccgcctg
ctcacctaccttcgcaccaacatcctcattgtgctcctagtggtcggagccatcagcgcc
atcttctgggccaccaagtactcacaggacaacaaggaggagtccctttttctggtgctc
cagtacttgcctcctggagtcatctccctggtcaacttcctgggcccccaattgttcaca
gtcctgatccagctggagaactaccctcccggcactgaagtcaacctcaccctgatctgg
tgcgtggtgctgaagctggccagcttgggcatgttctccttctccctgggtcagacggtg
ctgtgcataggcagaaacaagaccagctgcgagtcctacggctacaacgcttgcgactac
cagtgctgggagaactcggtgggcgaagaattatataagttaatcatcttcaacttcctg
ctcaccgtggccttcgccttcctggtcagcctgcctcgaaggctgttagtggagcgcttc
tcgggctggttctggacttggctagaccgggaggagttcctggtgcctaagaatgtgctg
gacatcgtggctgcacagactgtcacctggatgggcctcttctactgccccctgctgcca
ctactcaacagtgtcttcctctttctcaccttctacatcaagaagtacaccctcctgagg
aactccagggcgtccccgcggcgtttccgagcctccagctccaccttcttcttccacctg
gtgctgctcctaggcctgcttttggctgcagtacctctggcctacgtgatcagcagcacc
cactcctcctgggactgtggcctcttcacaaactattcggccccctggcaggtggtaccc
gagctggtagccctccagctcccacttcctagccagcgtgccctccgttacctcagctcc
cacgccttcagcttcccactcctcattctgctcagcatcgtcctgacggtttgcatctcc
cagtcccgggcgaatgccagagccatccaggggctgaggaagcaactggtgtggcaggtc
caggaaaagtggcacctggtggacgacctgtcgcggctgctgccagaactgagcccagag
cccgggtcccctcactctcgagcttcgcgtccacgatccttctgtcctggatttccatgc
ccaggctcgcccggtcccaggacacccaggctggcaccctccaacaggctgagctcctcg
agcctcggagcccccagtgcctcggttcctgcctccagatttcacttccccagccgcaca
gagctgtag

DBGET integrated database retrieval system