KEGG   Mus musculus (mouse): 217365
Entry
217365            CDS       T01002                                 

Gene name
Nploc4, AK129375, Npl4, mKIAA1499
Definition
(RefSeq) NPL4 homolog, ubiquitin recognition factor
  KO
K14015  nuclear protein localization protein 4 homolog
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    217365 (Nploc4)
SSDB
Motif
Pfam: NPL4 zf-NPL4 UN_NPL4 zf-RanBP
Other DBs
NCBI-GeneID: 217365
NCBI-ProteinID: NP_001181952
MGI: 2679787
Ensembl: ENSMUSG00000039703
Vega: OTTMUSG00000004173
UniProt: P60670 Q3UDU9
Structure
PDB: 
2PJH

Position
11; 11 E2
AA seq 608 aa
MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASS
SKSLHLLKIKHGDLLFLFPSSLAGPSSEMETSTSVGLKAFGAPNVVEDEIDQYLSKQDGK
IYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKF
VALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDF
WRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIA
AKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPD
GHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQY
VPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLG
ETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELA
QTWKKSEQWATIEQLCSTVGVQLPGLHEFGAVGGSARAATSAMWACQHCTFMNQPGTGHC
EMCSLPRT
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggccgagagcatcataatccgtgtccagtcccctgatggcgtgaagaggatcacagct
acgaagagagagacggctgccaccttcctgaaaaaggttgcaaaggagtttggcttccaa
aacaacggcttctcagtttacatcaatagaaacaagactggagagataacagcatcgtcc
agcaaatccctccatttgctaaaaatcaagcatggcgatttgttgttcctgtttccctca
agccttgctggaccctcgtctgaaatggaaacatcgacctcggtagggttaaaggccttt
ggtgctcctaacgtggttgaagatgagatcgatcaatacctcagcaagcaggatgggaag
atttaccggagccgagacccacagctatgccgccatggtcccttgggcaagtgtgtgcat
tgtgtcccactggagccatttgatgaggactatctgaaccacttggagcctcctgtgaag
cacatgtccttccatgcctacatccggaagctgactggaggggctgacaagggtaagttt
gttgccctggagaacatcagctgcaagattaagtcagggtgtgagggacacctcccatgg
ccaaatggtatctgcaccaaatgccagcccagtgccatcacgctgaacagacagaaatac
cgacacgtggacaacatcatgtttgagaatcatactgttgctgaccgcttccttgacttc
tggagaaagaccggaaaccagcattttgggtacttatacggacggtacacagagcacaag
gacattcccctcggcatcagggctgaagtggctgcaatttacgagcctcctcagattggt
acacagaacagtctggagcttctggaagacccgaaagctgaggtggttgacgagattgcc
gccaaacttggcctgaggaaggttggatggatattcacggaccttgtctcagaagacacc
cgaaagggtacagtccgatacagtcggaataaggacacctatttcctgagttcagaagaa
tgcatcactgcaggagactttcaaaacaagcaccccaacatttgccggctctctcccgat
ggtcattttggatccaagtttgttactgcagtggccacaggtggtcctgacaaccaggtt
cactttgaagggtaccaggtatccaatcagtgcatggcactagtccgagatgagtgtctt
ctaccttgtaaggatgcccctgagcttggctatgctaaggagtccagcagtgagcagtat
gttcctgatgtgttttataaggacatagacaagtttggcaatgagatcacccagctggcc
cgtcccctgcctgtggagtatctcatcatagatatcacaaccaccttccccaaggatcca
gtttacactttttctatttctcaaaatccgtttcctatcgaaaaccgggatgtactgggt
gaaacacaggacttccatagtttggccacctacttgtcccagaatacctcatccgtgttc
ttggataccatttccgacttccatctcctgctgtttctggtcaccaatgaagtcatgccg
ctgcaggacagtatcagcctgctgctagaagccgtgaggaccagaaatgaggagctagca
cagacatggaaaaagtctgaacagtgggccaccattgagcagttatgcagcaccgttggt
gtgcagctcccaggcctccacgagtttggtgcagtcgggggctctgcacgcgctgctacc
tctgccatgtgggcctgtcagcactgcaccttcatgaaccaacctggcacaggccactgc
gagatgtgcagcctcccccggacctag

DBGET integrated database retrieval system