KEGG   Mus musculus (house mouse): 217371
Entry
217371            CDS       T01002                                 
Symbol
Rab40b, SEC4L, rar
Name
(RefSeq) Rab40B, member RAS oncogene family
  KO
K07928  Ras-related protein Rab-40
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    217371 (Rab40b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    217371 (Rab40b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     217371 (Rab40b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab40
    217371 (Rab40b)
SSDB
Motif
Pfam: Ras Roc SOCS_box
Other DBs
NCBI-GeneID: 217371
NCBI-ProteinID: NP_001391611
MGI: 2183451
Ensembl: ENSMUSG00000025170
Position
11:complement(121246947..121279088)
AA seq 307 aa
MSSLGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDHKTTTILLDG
RRVKLQLWKPGLFYCTLPEASGTRTMLKNNQSQKLERDTSGQGRFCTIFRSYSRGAQGVV
LVYDIANRWSFDGINRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVT
FFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQELCCRAVVSCTPGHLVDK
LPLPVALRSHLKSFSMASGLNTRMMHGRSYSLTANSSHKRNSFRKVRTIRPPQSPPRNCA
RNSCKIS
NT seq 924 nt   +upstreamnt  +downstreamnt
atgagctccctgggcagcccggtgcgggcctacgattttctacttaagttcctgttggtg
ggcgacagcgacgtgggcaagggagagatcctggccagcttgcaggacggagcagccgag
tctccttacggccacccggcgggaattgatcacaagacgaccaccatcctgctagatggc
cgaagggtgaaactgcagctttggaagccaggcctattttactgcactcttccagaggct
tcagggactcgtaccatgctcaaaaacaatcaatcccagaagctggagagggacacctcg
gggcaggggagattttgtaccatattccgctcatactccagaggtgcacagggtgtggtc
ctggtctatgacattgccaaccgatggtcctttgatggcattaatcgatggattaaggag
attgatgagcatgcccctggggttcctaaaatcttggtgggaaatcggctgcacctggca
ttcaagcgacaggtgcccactgaacaggcccaggcctacgccgagcgcctgggtgtgacc
ttctttgaggttagccctctgtgcaacttcaacattacagagtccttcacagagctggct
aggatcgtgctgctgcggcatgggatggaccgtctctggaggccgagcaaggtactgagt
ttgcaagagctctgctgccgtgctgtggtgtcctgcacgcctgggcacctggtagacaag
ctccccctccctgtcgccttaagaagccaccttaagtctttctcgatggccagtggcctg
aacaccaggatgatgcatggccgctcctactccctcactgccaactccagccacaagagg
aacagcttccggaaagtcaggaccatccgcccaccccagagcccgcccaggaactgtgcc
aggaacagctgcaaaatttcttag

DBGET integrated database retrieval system