KEGG   Mus musculus (mouse): 217379
Entry
217379            CDS       T01002                                 

Symbol
Ubxn2a, 6330407P03Rik, Ubxd4
Name
(RefSeq) UBX domain protein 2A
  KO
K24349  UBX domain-containing protein 2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    217379 (Ubxn2a)
SSDB
Motif
Pfam: SEP UBX Spt20 LPD11
Other DBs
NCBI-GeneID: 217379
NCBI-ProteinID: NP_663416
MGI: 2442310
Ensembl: ENSMUSG00000020634
Vega: OTTMUSG00000033224
UniProt: Q99KJ0
Position
12:complement(4926814..4957749)
AA seq 258 aa
MKEVDNLDSIKEEWACETGPPDSQPLNDNQQKDCEYFVDSLFEEAGKAGAKCLSPTEQKK
QVDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELWGIFDKEEVDVKVEDKK
NEVCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSVEVDNKSTLSAVSLNNLEPITRIQIW
LANGERTVQRFNVSHRVSHIKDFIEKYQGSQRSPPFALATALPFLRFLDETLTLEEADLK
NAVIIQRLQKTAEPFRKL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaaagaagtagataatcttgacagtataaaagaagaatgggcttgtgaaacaggacct
cctgacagtcaacccctcaatgataatcaacaaaaggactgtgaatattttgttgacagc
ctttttgaggaagcagggaaggctggtgccaaatgcttgtcccccactgaacagaagaaa
caggtagatgtaaatataaaattgtggaaaaacggattcactgtcaatgatgattttaga
agttactctgatggtgcaagtcagcagtttctgaactccatcaaaaagggggaattacct
tcagaattatggggaatttttgataaagaggaggtggatgttaaagttgaagataagaaa
aatgaagtatgtatgtctacaaagcctgtgttccagcccttctcaggacagggccacaga
ctaggaagtgctacaccaagaatcgtttctaaagcaaagagtgttgaagttgacaataaa
agtactttgtctgctgtttcactgaacaacttggagcccattaccaggatccagatctgg
ttagccaatggggaaagaactgtccaaagatttaatgtttctcatagggtgagccacatc
aaagacttcattgaaaaataccaaggatctcagagaagccctccctttgccctggcaaca
gctcttcctttcctcaggtttctggatgaaacgctcacattggaagaagcagatttgaag
aatgctgtaatcattcagagactccaaaaaactgccgagccttttagaaaactttga

DBGET integrated database retrieval system