KEGG   Mus musculus (mouse): 217379Help
Entry
217379            CDS       T01002                                 

Gene name
Ubxn2a, 6330407P03Rik, Ubxd4
Definition
(RefSeq) UBX domain protein 2A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SEP UBX
Motif
Other DBs
NCBI-GeneID: 217379
NCBI-ProteinID: NP_663416
MGI: 2442310
Ensembl: ENSMUSG00000020634
Vega: OTTMUSG00000033224
UniProt: Q99KJ0
Position
12; 12 A1.1
AA seq 258 aa AA seqDB search
MKEVDNLDSIKEEWACETGPPDSQPLNDNQQKDCEYFVDSLFEEAGKAGAKCLSPTEQKK
QVDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELWGIFDKEEVDVKVEDKK
NEVCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSVEVDNKSTLSAVSLNNLEPITRIQIW
LANGERTVQRFNVSHRVSHIKDFIEKYQGSQRSPPFALATALPFLRFLDETLTLEEADLK
NAVIIQRLQKTAEPFRKL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagataatcttgacagtataaaagaagaatgggcttgtgaaacaggacct
cctgacagtcaacccctcaatgataatcaacaaaaggactgtgaatattttgttgacagc
ctttttgaggaagcagggaaggctggtgccaaatgcttgtcccccactgaacagaagaaa
caggtagatgtaaatataaaattgtggaaaaacggattcactgtcaatgatgattttaga
agttactctgatggtgcaagtcagcagtttctgaactccatcaaaaagggggaattacct
tcagaattatggggaatttttgataaagaggaggtggatgttaaagttgaagataagaaa
aatgaagtatgtatgtctacaaagcctgtgttccagcccttctcaggacagggccacaga
ctaggaagtgctacaccaagaatcgtttctaaagcaaagagtgttgaagttgacaataaa
agtactttgtctgctgtttcactgaacaacttggagcccattaccaggatccagatctgg
ttagccaatggggaaagaactgtccaaagatttaatgtttctcatagggtgagccacatc
aaagacttcattgaaaaataccaaggatctcagagaagccctccctttgccctggcaaca
gctcttcctttcctcaggtttctggatgaaacgctcacattggaagaagcagatttgaag
aatgctgtaatcattcagagactccaaaaaactgccgagccttttagaaaactttga

DBGET integrated database retrieval system