KEGG   Mus musculus (mouse): 217410Help
Entry
217410            CDS       T01002                                 

Gene name
Trib2, AW319517, TRB-2, TRB2
Definition
(RefSeq) tribbles pseudokinase 2
  KO
K08814  tribbles homolog 1/2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    217410 (Trib2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  Trbl family
   217410 (Trib2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 217410
NCBI-ProteinID: NP_653134
MGI: 2145021
Ensembl: ENSMUSG00000020601
Vega: OTTMUSG00000027552
UniProt: Q8K4K3
Position
12; 12 A1.1
AA seq 343 aa AA seqDB search
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSC
IGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFEISCYQESLAPCFCLSAHSNINQITEIL
LGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRK
FIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSL
GVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQ
EILDHPWFSTDFSVSNSGFGAKEACDQLVPDVNMEENLDPFFN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacaggtctacccctatcacaatagcgagatatgggagatcgcggaacaaa
acccaggatttcgaagagctgtcgtctataaggtccgctgagcccagccagagtttcagc
ccgaaccttggctctccgagcccgcccgagactccgaacttgtcgcattgcgtttcttgc
atcgggaaatacttactgttggagcctctggagggagaccacgttttccgcgctgtgcat
ctgcacagcggagaggagctggtttgcaaggtgtttgagatcagctgctaccaggagtcc
ctggccccctgcttctgcctgtctgcccatagcaacatcaaccaaatcacggaaatcctc
ctgggagagaccaaagcctatgtgttctttgagcgaagctatggagacatgcattccttt
gtccgcacttgtaagaagctgagggaggaggaggcagcccgactgttctaccagattgcc
tcagctgtggcccattgccacgatggaggcctggtgctgcgtgacctcaagctgcggaaa
tttatcttcaaggatgaagagaggactcgtgtcaagctggagagtttggaagacgcttac
attctccggggtgatgatgactcactctctgacaagcatggctgcccagcgtatgtcagc
ccagagatcttgaacaccagcggcagttattcgggcaaggcagcggacgtgtggagcctg
ggggtaatgctgtacaccatgttggtggggcgttaccctttccatgacattgagcctagt
tctcttttcagtaagatccgcaggggccagttcaacattccagaaactctgtctcccaag
gccaagtgcctcatccgaagcatcctgcgacgggagccgtcagagcggctgacctcgcag
gaaattctggaccatccttggttttctacagattttagtgtctcaaattcgggatttggt
gctaaagaggcgtgtgaccagctggtgccagacgtcaacatggaggagaacttggaccct
ttctttaactga

DBGET integrated database retrieval system