KEGG   Mus musculus (house mouse): 21743
Entry
21743             CDS       T01002                                 
Symbol
Inmt, Temt
Name
(RefSeq) indolethylamine N-methyltransferase
  KO
K00562  methyltransferase [EC:2.1.1.49 2.1.1.96]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00380  Tryptophan metabolism
mmu00450  Selenocompound metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    21743 (Inmt)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    21743 (Inmt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.49  amine N-methyltransferase
     21743 (Inmt)
    2.1.1.96  thioether S-methyltransferase
     21743 (Inmt)
SSDB
Motif
Pfam: NNMT_PNMT_TEMT Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23
Other DBs
NCBI-GeneID: 21743
NCBI-ProteinID: NP_033375
MGI: 102963
Ensembl: ENSMUSG00000003477
UniProt: P40936
Position
6:complement(55147612..55151975)
AA seq 264 aa
MEGKVYIGGEDYEKEFTPKDYLTTYYSFHSGPVAEQEIVKFSLQNLYQTFSTGGVGGDVL
IDIGSGPTIYQLLSACEVFREIIVTDYTPQNLQELQKWLKKEPGAYDWSSIVQHACELEG
DRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDIDTYRAA
LRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKEVVEKAIQDAGCQVLKCNCVS
LSYSEAYCSHDGLCFVVARKGPSA
NT seq 795 nt   +upstreamnt  +downstreamnt
atggagggcaaggtatacataggaggtgaggactatgaaaaagagttcactcccaaagac
tacctgaccacctactacagcttccactctggccctgtggcagagcaggaaatcgtaaag
tttagcctgcagaacctctaccagaccttctctacaggaggtgtagggggcgacgtcctg
atcgacattggctctggccctaccatctaccagctgctttcagcatgcgaggtcttccgg
gagatcattgtcactgactacaccccgcagaacctgcaggagctgcagaagtggctgaag
aaagagccaggagcctacgactggtcctccatagtgcaacatgcatgtgagctggaggga
gacagaagcaggtggcaggagaaggaagccaagctcagaaggacagtcactcgtgtcctg
aggtgtgatgtgaccaagacacccccgctggggtcagctcaggtgcctctggctgactgc
gtgctgacctttctggccatggagtgtgcctgccctgatatagatacctaccgggcagcc
ttgcgcagactggccggcctgctgaaaccaggagggcacctggtgaccctggttactctg
cgcttccagcactatatggtgggccccaagaagttctctggggtctacctagagaaggag
gtggtggagaaggctattcaagatgctggctgtcaggtgctgaagtgcaactgcgtctcc
ctcagctactcggaggcttactgctcccacgacggtttgtgctttgtggtggcccggaag
ggtcccagtgcctga

DBGET integrated database retrieval system