KEGG   Mus musculus (mouse): 217430
Entry
217430            CDS       T01002                                 

Symbol
Pqlc3, C78076, E030024M05Rik, Slc66a3
Name
(RefSeq) PQ loop repeat containing
  KO
K23680  solute carrier family 66, member 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    217430 (Pqlc3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC66: Lysosomal lysine-arginine transporter
   217430 (Pqlc3)
SSDB
Motif
Pfam: PQ-loop
Other DBs
NCBI-GeneID: 217430
NCBI-ProteinID: NP_766162
MGI: 2444067
Ensembl: ENSMUSG00000045679
Vega: OTTMUSG00000027499
UniProt: Q8C6U2 Q3UU83
Position
12; 12 A1.1
AA seq 202 aa
MEAGLLWFCNWSTLGVCAALKLPQIYAQLAARSARGISLPSLLLELAGFLVFLRYQHYYG
NPLLTYLEYPILIAQDIVLLLFVFHFNGNVKQALPYMAVFVSSWFILSLQKWIIDLAMNL
CTVISAASKFAQLQYLWKVQDSGAVSALTWGLSAYTCATRIITTLMTTNDLTILIRFVIM
LALNIWVTATVLHYRKSATKAE
NT seq 609 nt   +upstreamnt  +downstreamnt
atggaggccggactgctatggttctgcaactggagcacgctgggcgtctgcgccgcactc
aagctgccgcagatttacgcgcagctggcggcgcgcagcgcgcggggcatcagcctccct
agtttacttttggagctggcggggttcctggtcttccttcgttatcagcattactatggg
aacccactgctcacctatctggaataccccattctcatcgcacaagacattgtcctcctg
ctcttcgtctttcatttcaatgggaacgtgaagcaagccttaccctacatggccgtattt
gtgtcttcttggttcatcctcagcctgcagaaatggatcatcgacttggccatgaactta
tgcacagtcattagtgcagccagtaagtttgcccagctccagtatttgtggaaggtacaa
gattcaggagctgtgagcgcactgacctggggcctttctgcctacacctgtgcaacaaga
ataataacaactttaatgaccaccaatgacttgacaattcttatacgttttgtgatcatg
ttggctttaaatatatgggtaacagcaacagtacttcactaccggaagtctgccaccaaa
gctgaatga

DBGET integrated database retrieval system