KEGG   Mus musculus (mouse): 217431Help
Entry
217431            CDS       T01002                                 

Gene name
Nol10, Gm67
Definition
(RefSeq) nucleolar protein 10
  KO
K14788  ribosome biogenesis protein ENP2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    217431 (Nol10)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    217431 (Nol10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUC153
Motif
Other DBs
NCBI-GeneID: 217431
NCBI-ProteinID: NP_001008421
MGI: 2684913
Ensembl: ENSMUSG00000061458
UniProt: Q5RJG1 Q3TUB5
Position
12; 12 A1.1
AA seq 687 aa AA seqDB search
MQVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKNVDVRRRIELIQDFEMPTVCTTIKV
SKDGQYILATGTYKPRVRCYDTYQLSLKFERCLDSEVVTFEILSDDYSKIVFLHNDRYIE
FHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQGRYLNPLQTDAAENN
VCDINAVHGLFATGTIEGRVECWDPRVRKRVGVLDCALNSVTADSEINSLPTISALKFNG
ALSMAVGTSTGQVLLYDLRSDKPLLVKDHQYGLPIKSVHFQDSLDLVLSADSRIVKMWNK
DSGKIFTSLEPEHDLNDVCLYPSSGMLLTANESPKMGIYYIPVLGPAPRWCSFLDNLTEE
LEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMHGFFMDIRLYHKVKLMVNPFA
YEEYRKDKIRQKIEETRAQRVQLKKLPKVNKELALKLIEEEEEKQKSTLKKKVKSLPNIL
TDDRFKVMFENPDFQVDEESEEFRLLNPLVSRISEKRKKQLRLLEQQELKDEEEEEPEGK
PSDAESSESSDDEKGWVEEVRKQRRLLQQEERVKRQEQLKEDQQTVLKPQFYEIKAGEEF
RSFKESATKQRLMNKTLEDRLKLEAKHGTLNVSDTTVGSKQLTFTLKRSEQQKKQQEAEK
LHRQERKNLRRSASHLRSRPRRGRPFH
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccagcctcaacgaagtgaagatttacagcctcagctgcggcaagtctctt
cccgagtggctttctgacaggaagaagagagcactgcagaagaagaatgtcgatgttcgt
aggagaattgaacttattcaggacttcgaaatgcctactgtgtgtactactatcaaggtg
tcaaaagatggacagtatattttagcaactggaacatataagcctcgggtccggtgttat
gacacatatcagttatccctgaagtttgaaaggtgcttggattctgaagttgtcaccttt
gagattttatcagatgactattcaaagattgtcttcttacataatgacagatatattgaa
tttcactcacaatcaggcttttactacaaaaccagaattcccaagttcggccgagacttc
tcttaccactatccatcctgtgacttgtactttgtaggtgcaagctctgaagtttataga
ttaaacttagaacaagggcggtacctgaatcctctccagacggacgccgcggagaacaat
gtttgtgacataaatgcagtgcatggcttgttcgccacaggaacaatagagggtcgagtg
gaatgctgggatccaagagtaagaaaaagggttggcgtgttagactgtgcattaaatagt
gtcacagcagattcagagataaacagcttacccaccatctctgcattgaagtttaatgga
gccttgagcatggcagttggaacatccacagggcaggtgttgttatatgatcttcgctcg
gataagccgttgctagttaaggatcaccagtatgggctgccgattaagtcagttcatttc
caggattccctagatttggttttgtctgcagactctagaattgtcaaaatgtggaacaag
gactccgggaaaatatttacttcgttggagccagaacatgatcttaatgatgtttgcctc
tatcccagctcaggaatgcttcttactgccaatgaatcccccaagatgggcatttactac
attccggttttgggtcctgctcccaggtggtgttccttcctggacaacttgacagaagag
ttagaagagaatccagagagcacagtgtatgatgattacaaatttgtcaccaagaaagac
cttgaaaatttagggctcacacatctcattggatcacctttcctccgagcatatatgcat
gggtttttcatggatatcagactctaccacaaggtgaaattgatggtcaatccatttgct
tatgaagaatataggaaagataaaattcgacagaagatagaagaaacacgtgcacagaga
gtccaattaaagaaactgccaaaagttaacaaagaactggcacttaaattaattgaagag
gaagaggagaaacaaaagtctacgctgaaaaagaaagttaagagcctccctaatatcctc
acggatgatcgatttaaagttatgtttgagaatcccgacttccaggtggacgaggagagt
gaagagttcaggcttctcaaccccctcgtctcgaggatcagtgagaagaggaagaagcag
ctgaggctcttggagcagcaggagctcaaggatgaagaggaggaagaaccggaaggaaaa
cccagtgatgcagaaagttcagagagctcagatgatgagaaaggttgggttgaagaagtc
aggaagcagcgcagactccttcagcaggaagaaagagtgaagcggcaggagcaactgaag
gaggaccagcagacagtcctgaagccccagttctacgagatcaaagcaggcgaagagttc
aggagcttcaaagagtctgccaccaagcagagactaatgaacaaaactctggaagatcgt
ttgaaacttgaagcaaaacatgggacattgaatgtatcggacaccactgttggcagcaag
cagttgacatttactctcaagaggtctgaacagcaaaagaagcaacaggaggctgaaaaa
ctgcatcgtcaggaaaggaaaaatctgcgcaggtcggccagccacctgaggtccagaccc
agaagaggccggccctttcactga

DBGET integrated database retrieval system