KEGG   Mus musculus (mouse): 217449
Entry
217449            CDS       T01002                                 

Symbol
Trappc12, CGI-8, CGI-87, D930014A20Rik, Ttc15
Name
(RefSeq) trafficking protein particle complex 12
  KO
K20309  trafficking protein particle complex subunit 12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    217449 (Trappc12)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    217449 (Trappc12)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_12 TPR_19 TPR_16 TPR_8 TPR_17 TPR_6 Coatomer_E ANAPC3 TPR_9 TPR_MalT TPR_15
Other DBs
NCBI-GeneID: 217449
NCBI-ProteinID: NP_001154882
MGI: 2445089
Ensembl: ENSMUSG00000020628
UniProt: Q8K2L8 Q3UGE1
Position
12; 12 A2
AA seq 797 aa
METAKDGEQSPSEASPSAQAGPENIPEPMSREEESQPLYHEETIDLGGDEFASEENEPTS
EGSHNFGDKLNEHMMESVLISDSPNNSEGDVGDLGCLQDVGEPPRGATDHRLPSSTDKEV
VDTLSNGSETDGDDTPRDISDMTPDSRASLKEDSTQEDVTSMPALENAATEEVGPKDSLA
PREEQTSEVSSNQSSSKDEPLPVCTIFSQATATPSQPHLFLQDGFESQMVKSPSFSSTSE
TSAKTPPPMVQPSPSLSTFFGDTMSSNSLASDFFDSFTTSTFISVSNPNAGSPVPEKLSS
LTAPVGEKSPDSTSPSYSTRMDRSESGVSRAPLDVPESPKPFSQIQAVFAGSDDPFATAL
SMSEMDRRNDAWLPSQATREVLMSVATQQYGTVFIDKENLTMPGLKFDNIQGDAVKDLML
RFLGEKAAAKRQVLNASSVEQSFVGLKQLISCRNWRAAVDLCGRLLTAHGQGYGKNGLPT
SHTTDSLQLWFVRLALLVKLGLFQNAEMEFEPFGNLDQPDLYYEYYPHVYPGRRGSMVPF
SMRILHAELQQYLGNPQESLDRLHRVKTVCSKILANLEQGLAEDGGLSSVTQESRQASVQ
LWRSRLGRVLYSMANCLLLMKDYVLAVDAYLTVIKYYPEQEPQLLSGIGRILLQIGDIKT
AEKYFQDVEKVTQKLDGLQGKIMVLMNRAFLYLGQNNFAEAHKFFTEILRMDPTNAVANN
NAAVCLLYLGKLKDSLRQLEAMVQQDPRHYLHESVLFNLTTMYELESSRSMQKKQSLLEA
VASKEGDSFNTQCLKLA
NT seq 2394 nt   +upstreamnt  +downstreamnt
atggaaacagctaaagatggtgagcagagcccaagtgaggcatctccttcagcccaggca
ggtcctgaaaacatcccggagcctatgtctcgggaggaggagagccagccattgtaccat
gaagagaccattgatcttggtggagatgagtttgcatctgaagagaacgagcccacatcg
gaagggtctcacaacttcggagataagcttaatgagcacatgatggaaagtgtgctcatc
tccgactctcctaacaacagcgagggggacgttggcgacctcggctgtctacaggatgtt
ggggagccccccagaggtgccactgatcaccgactgcccagtagcacagacaaagaagtg
gtggacactctgagtaatggcagtgaaaccgatggagacgacactcccagagacatctca
gacatgacacctgatagcagagcctctctgaaggaagactcaacacaggaagatgtgacg
agcatgcctgcactggagaatgctgccacggaggaagtcgggcctaaggacagcctcgcg
ccccgagaagagcagacctcagaagtgtcctccaatcagtcctcctccaaagacgagccc
ttgcccgtctgcaccatcttcagccaggctaccgccactccctcccagccacacctgttt
ctacaggatggcttcgagtcccagatggtgaaatcacccagtttcagtagcaccagtgag
acgtcagccaagacccctcctccgatggtccagcccagtcccagcctcagtacatttttt
ggagatacaatgagctctaattccttggcctctgacttctttgattccttcacaacttct
actttcatttcagtcagtaatcccaatgcaggttccccagttccagaaaagctgtcttca
ctcactgcccctgtaggagagaagtccccggattccaccagcccatcttactccacaagg
atggatagatcggaatcaggtgtttctcgggcccctctggatgtccctgaatctccaaag
ccattttcacagatccaggctgtgtttgctggaagtgatgaccccttcgccacagccctg
agcatgagtgagatggaccggaggaatgacgcatggcttcccagtcaggcgaccagagaa
gtcctgatgtcagtagcaacccagcagtatggcactgtgttcatagacaaggagaacctc
actatgcctggcctcaagtttgacaacattcagggagatgcagttaaagacttgatgctt
cgcttcctgggtgagaaggctgcagcaaagagacaggtcttaaatgccagctcagtggag
cagtcctttgtggggctgaagcagctcattagctgcaggaactggagggcagcagtcgac
ctgtgtggacgcctgctcacagcccacggacaaggctatggcaagaatgggctgcccacc
agccacaccacagactccttgcagctctggtttgtgaggttggcgctgctggtgaagttg
ggccttttccagaatgctgagatggagtttgaaccctttggaaatctggatcaaccagac
ctatactatgaatactacccacacgtgtacccaggacgcaggggctccatggtccccttt
tcgatgcgtattctgcatgcagaactgcagcagtatctggggaacccacaggagtccctg
gaccgattacacagggtcaagaccgtctgcagcaagatcttggccaacttggagcaaggc
ttagctgaagatggtggtctgagcagcgtcacccaggaaagcaggcaagcctctgttcag
ctgtggaggtctcgtctgggccgtgtgctgtactccatggcaaactgtctgctcctgatg
aaggactatgtgctggctgtggatgcctacctcacagtaatcaagtactacccggagcag
gagccacagctgctgagtggaatcggccgcattctcctccagatcggagacataaaaaca
gctgaaaaatattttcaagacgttgagaaagtaactcagaagttggatggactgcagggt
aaaataatggtcctaatgaacagagcctttctgtaccttggccagaataacttcgcagaa
gctcacaagttcttcacagagattttgagaatggacccaacaaatgcagtggccaacaac
aatgctgctgtgtgtctgctttacctgggaaagctcaaggactccctgcggcagctggag
gccatggtgcagcaggaccccaggcactacctgcacgagagcgtgctcttcaacctgacc
accatgtacgagctggagtcctcaaggagcatgcaaaagaagcagagcctacttgaggcc
gttgctagcaaagaaggggacagcttcaacacacagtgcctgaagctggcttag

DBGET integrated database retrieval system