KEGG   Mus musculus (mouse): 217480Help
Entry
217480            CDS       T01002                                 

Gene name
Dgkb, 6430574F24, 90kda, C630029D13Rik, DAGK2, DGK, DGK-beta, mKIAA0718
Definition
(RefSeq) diacylglycerol kinase, beta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    217480 (Dgkb)
   00564 Glycerophospholipid metabolism
    217480 (Dgkb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    217480 (Dgkb)
   04072 Phospholipase D signaling pathway
    217480 (Dgkb)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    217480 (Dgkb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     217480 (Dgkb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 SPARC_Ca_bdg C1_2
Motif
Other DBs
NCBI-GeneID: 217480
NCBI-ProteinID: NP_848796
MGI: 2442474
Ensembl: ENSMUSG00000036095
UniProt: Q6NS52
Position
12; 12 A3
AA seq 795 aa AA seqDB search
MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGTIDFEGFKLFM
KTFLEAELPDDFTAHLFMSFSNKFPHSSPNVKSKPALLSGGLRMNKGAITPPRSSPANTC
SPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIIGQMMHVAEYL
EWDVTELNPILHEMMEEIDYDRDGTVSLEEWIQGGMTTIPLLVLLGLENNVKDDGQHVWR
LKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKKNTDVM
HHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHIL
PPTTICPVVLTMPSAGASVPEERQSTAKKEKSSSQQPNKATDKNKMQRANSVTMDGQGLQ
ITPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDF
RVLACGGDGTVGWILDCIEKANVVKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILK
DIESSTEIMLDRWKFEVTPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEK
FNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHG
GSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQI
YTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPMLMGPPPKTG
LFCSLIKRTRNRSKE
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccaggaaaaatgggcccatctcagcccctcagaattttcccaacttcagaaa
tatgctgagtattctacaaagaaattaaaggatgttcttgaagaattccatggtaatggc
gtgcttgcaaagtataatcctgaagggaccatagattttgaaggcttcaagctattcatg
aagacctttctggaagctgagctgcctgacgatttcaccgcccacctttttatgtcattc
agcaacaaatttccccattctagcccaaatgtaaagagtaagcccgctcttctttcaggt
ggtctcaggatgaataagggtgccatcacccctccacgttcctctccagcaaatacatgc
tccccagaagtgatccacctcaaggatatcgtctgctacctgtctcttctcgaaagagga
agacccgaggataagctcgagtttatgtttcgcctttatgacaccgatgggaatggcttc
ctggacagctcggaattagaaaatattattggtcagatgatgcacgtggcagagtacctc
gaatgggatgttaccgaacttaatccgatccttcatgaaatgatggaagaaattgactat
gaccgggatggcactgtgtctctggaggagtggattcaaggaggaatgacaactatccca
cttctagtcctgctgggcttggagaataatgtgaaggatgatggacagcatgtgtggcga
ctcaagcactttaacaagcctgcctactgcaatctctgcctgaacatgctgattggcgtg
gggaagcagggcctctgctgctccttctgcaagtacacggtccatgagcgctgtgtggcc
agagccccgccctcctgcatcaagacatatgtgaagtccaagaaaaacacagacgtcatg
caccactattgggtcgaaggcaattgcccaaccaagtgcgataagtgccacaaaacagtg
aaatgttaccagggcctgacgggcctgcattgtgtttggtgccagaccacactgcacaat
aaatgtgcttctcatctgaagcccgagtgtgactgtggacccttgaaggaccatattttg
ccacctaccacaatctgtccagttgtattgactatgcccagtgctggagcctcagttcct
gaggaaagacagtccacagctaaaaaggaaaagagcagctcccagcagccaaataaagca
acagacaaaaataaaatgcaaagagctaactcagttactatggatggacaaggtttgcag
atcactcctgttcctggcacacatccgcttctagtttttgtcaaccctaaaagtggtggg
aagcaaggagaacgaatttacagaaaattccagtatctcctaaatcctcgtcaggtttac
agtctttctggaaatggaccaatgccagggttacacttttttcgcgatgtccctgacttc
agagtgttagcatgcggtggagatgggactgtgggctggattttggattgcatagagaag
gccaatgtagtcaagcaccctccagttgccatcctgcctcttgggactggcaatgactta
gcaaggtgcctgcggtggggtggaggttatgaaggggaaaatcttatgaagatcctaaaa
gacattgaaagcagcacagaaatcatgctggacaggtggaagtttgaagtcacacccaac
gacaaagatgagaaaggagaccctgtgccttacagcatcatcaataactacttttccatt
ggcgtggatgcctccattgcacacagattccacatcatgagagaaaagcacccagagaaa
ttcaacagccgaatgaagaacaaattttggtactttgagtttggcacatctgaaaccttc
tcagcgacctgcaagaagctgcatgaatctgtagaaatagaatgtgatggagtacaaata
gatttgataaacatctctctggaaggaattgcaattttgaatataccaagcatgcatgga
ggatctaatctttggggagagtctaaaaagaaaagaagccatcgacgaatagagaaaaaa
ggctctgacaaaagacccactctcacagatgcaaaagagctgaagtttgcaagtcaagat
ctgagtgaccagctgctggaggtcgttggcttggaaggagcaatggaaatgggccaaatt
tacacgggcctgaaaagtgcgggccggcggctggctcagtgctcctctgtggttatcaga
acaagcaagtcactgccaatgcagattgatggagagccctggatgcagaccccatgcaca
ataaaaattacacacaagaaccaagccccaatgctgatgggccctccacccaaaactgga
ttattctgctcacttatcaaaagaacaagaaaccgaagcaaggagtga

DBGET integrated database retrieval system