KEGG   Mus musculus (house mouse): 217517
Entry
217517            CDS       T01002                                 
Symbol
Stxbp6, BC024598, C85317
Name
(RefSeq) syntaxin binding protein 6 (amisyn)
  KO
K08519  syntaxin-binding protein 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    217517 (Stxbp6)
Membrane trafficking [BR:mmu04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Tomosyn
    217517 (Stxbp6)
SSDB
Motif
Pfam: Sec3-PIP2_bind Synaptobrevin
Other DBs
NCBI-GeneID: 217517
NCBI-ProteinID: NP_653135
MGI: 2384963
Ensembl: ENSMUSG00000046314
UniProt: Q3TYA4
Position
12:complement(44899267..45121901)
AA seq 210 aa
MSAKSAISKEIFAPLDERMLGAIQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQA
SITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNRDSAEFDLLFENAFDQWVASTASEKC
TFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERL
GRAEEKTEDMKNSAQQFAETAHKLAMKHKC
NT seq 633 nt   +upstreamnt  +downstreamnt
atgagtgccaagtctgccatcagcaaggaaatttttgcacctcttgatgaaagaatgctg
ggagccatccaagtcaagagaaggacaaagaaaaagattcctttcttggcaactgggggt
caaggcgaatacttaacttatatctgcctgtcagtgacaaacaaaaaacccacacaggca
tctatcacgaaggtcaaacagtttgagggctccacatcattcgtccgaagatcccaatgg
atgcttgagcagcttcgccaagttaatggtattgatcctaatcgggattctgcagagttt
gatttgttgtttgaaaatgcctttgaccagtgggttgctagcacggcctcagaaaagtgc
accttcttccagatcctccaccacacctgccagaggtacctcacagacaggaagccagag
tttattaactgccaatccaaaattatgggaggaaacagcatcctccattcagcagctgat
agtgtgaccagtgcagtacagaaggcaagccaggccttgaacgagcgtggggaacggtta
ggccgagcagaggagaagacagaagacatgaagaacagtgcccagcagtttgcagaaacc
gcacacaagcttgccatgaagcataaatgttga

DBGET integrated database retrieval system