KEGG   Mus musculus (mouse): 21754
Entry
21754             CDS       T01002                                 

Symbol
Tesk1, AI326901
Name
(RefSeq) testis specific protein kinase 1
  KO
K08841  testis-specific kinase 1 [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    21754 (Tesk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     21754 (Tesk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   21754 (Tesk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH Kdo
Other DBs
NCBI-GeneID: 21754
NCBI-ProteinID: NP_035701
MGI: 1201675
Ensembl: ENSMUSG00000028458
Vega: OTTMUSG00000006821
UniProt: O70146
Position
4; 4 A5
AA seq 627 aa
MAGERPPLRGPGPGEAPGEGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFDCAEKIGA
GFFSEVYKVRHRQSGQVMVLKMNKLPSNRSNTLREVQLMNRLRHPNILRFMGVCVHQGQL
HALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIAQGLRYLHAKGVFHRDLTSKNCLVRR
EDRGFTAVVGDFGLAEKIPVYREGTRKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGI
VLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGNDCPLPFLLLAIHCCSMEPSTRAPFT
EITQHLEQILEQQPEATPLAKPPLTKAPLTYNQGSVPRGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPSWGDNLTRVNPFSLREDLRGGKIKLLDTPCKPATPLPLVPPSPLTSTQLPL
VTTPDILVQPETPVRRCRSLPSSPELPRRMETALPGPGPSPMGPTEERMDCEGSSPEPEP
PGLAPQLPLAVATDNFISTCSSASQPWSPRSGPPLNNNPPAVVVNSPQGWAREPWNRAQH
SLPRAAALERTEPSPPPSAPREPEEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNC
EAGSLLCHRGHHAKPPTPSLQLPGARS
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggccggggaacggccgccgctgcggggccccgggcccggagaggctccgggggagggg
ccggggggcgcaggcggaggcccgggccggggccggccctcctcctaccgggccctccgc
agcgccgtgtccagccttgcgcgtgtggacgatttcgactgcgcagagaagatcggggcc
ggtttcttctctgaggtctacaaggttcggcaccgacagtcgggacaagtcatggtgctg
aagatgaacaagctccccagtaaccggagcaacacgctaagggaggtgcagctgatgaac
cggctccggcaccctaacatcctcaggttcatgggggtctgtgtgcaccaagggcagctg
cacgcgcttacagagtatatgaatgggggcaccctggaacagctgctcagctccccagaa
cccctctcctggccagtcaggctccacctagccctggacattgcacaaggcctacggtac
ctacacgccaaaggtgtgtttcaccgagacctcacatccaagaactgtctggtccgaagg
gaagaccgaggcttcacagctgttgtgggtgacttcggactggctgagaagattcctgtg
tatagggaagggacaaggaaggagcccttggctgtggtgggctccccgtactggatggct
ccagaggtgttgcggggagagctgtatgatgagaaggccgatgtcttcgccttcgggatc
gtcctctgtgagctcatcgcccgagtgcctgcagaccctgactacctaccccgcactgag
gactttggcctggatgtgcctgctttccgaactttggtgggaaatgactgtccgctacct
ttcctgcttctggccatccactgctgcagcatggaacccagcacccgggccccttttact
gaaatcacccagcacctggaacagatcctggagcagcagcctgaggccacgcccctcgcc
aagccacccctcaccaaggctcccttgacatacaatcaggggtctgttccaagaggaggt
ccctctgccacacttcccaggccagacccccggctctcccgaagccggtcagacctcttc
ctgccaccttcgccagaatcaccccccagctggggggacaatctaacacgagtcaacccc
ttctcactgcgggaagacctcaggggtggcaagatcaagctgctggacacaccctgcaag
ccggccactccactgcccctggttccaccatcaccacttacctctacccagctgccctta
gtgaccactccagacatcctggtccagcctgagacccctgtccgccgctgtcgctcacta
ccttcatcccctgagcttccccgacggatggagactgcactgccaggtcctggcccttcc
cccatgggcccgactgaggagaggatggactgcgagggcagcagccctgagccagagccc
ccaggcctggctccccagctgcctctggctgtggccactgacaacttcatcagtacttgt
tcctcagcctcgcagccctggtctcctagatcaggacctcccctcaacaataatccccct
gctgtggtggtgaattccccacaagggtgggctagggagccctggaaccgggcacagcat
agccttccccgggcagcagccctggagcggacagagccctcaccgcccccatcagctccc
cgggagccggaggaggggctgccctgccctggctgctgccttggcccgttcagctttggc
tttctatccatgtgcccccgccctaccccagctgttgcccgctaccgcaacttgaactgt
gaggcgggcagtcttctctgccaccgagggcatcatgccaagccacccacacccagcctg
cagctgcctggggcacgctcttag

DBGET integrated database retrieval system