KEGG   Mus musculus (mouse): 21756
Entry
21756             CDS       T01002                                 

Gene name
Prss40, Tesp2
Definition
(RefSeq) protease, serine 40
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2 DUF316
Other DBs
NCBI-GeneID: 21756
NCBI-ProteinID: NP_033382
MGI: 1270857
Ensembl: ENSMUSG00000037529
Vega: OTTMUSG00000022629
UniProt: A6H6T1
Position
1; 1 B
AA seq 365 aa
MCGIRAKKSGLGGYGAGLLAALLGVSFLSQHAQTAEHVTNAANNTTIQIMKSTLSLSEVC
GKTKFQGKIYGGQIAGAERWPWQASLRLYGRHICGAVLIDKNWVLSAAHCFQRSQEPSDY
HVMLGYTDLNSPTRYSRTMSVQKVIVHKDYNRFHTQGSDIVLLQLRSSVEYSSHILPACV
PEENIKIPKEKACWASGWGYLREDVRIPLPNELYEAELIIMSNDQCKGFFPPPVPGSGRS
YYIYDDMVCAADYDMSKSICAGDSGGPLVCLLEGSWYVVGLTSWSSTCEEPIVSPSVFAR
VSYFDKWIKDNKKSSSNSKPGESPHHPGSPENENPEGDNKNQGAVIKPTVCTALLLSQIL
LQQLI
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtgtggcatcagggccaaaaaatcgggcctgggtggatacggggccggcctgctggct
gctctgctcggagtgagcttcctgtcacagcatgcccagaccgcagaacacgtcaccaac
gctgcgaataacactaccatccagatcatgaagtccactctatccctgtcagaggtatgt
ggcaagaccaaattccaagggaagatctatggcggtcagattgcaggggctgagcggtgg
ccgtggcaggccagtctgcgcttatatggcaggcacatctgtggagcagttctcatcgac
aaaaactgggtactcagcgctgcccactgcttccaaagatctcaagaaccaagtgactac
catgtcatgctaggctacaccgacctgaacagtcccaccaggtacagcaggacgatgtca
gtgcagaaggtcatcgttcacaaagactacaacagattccacacccaaggaagtgacatt
gtcctgctgcagctgcgttcctctgtggagtacagctcccacatcctcccagcctgtgtc
cctgaggaaaacataaaaatccccaaagagaaggcctgctgggctagtggctggggctat
ctcagagaggacgtgcgaattcctttgcctaatgaactgtatgaagccgagctcatcatc
atgagtaatgaccagtgtaaaggatttttcccaccaccagttccgggatccggtagaagc
tactacatatatgatgatatggtgtgtgctgctgactatgacatgtcaaaatccatctgc
gcaggagattctgggggcccccttgtctgcttactggaaggctcctggtacgtggtaggg
ctaaccagctggagctctacatgtgaagaaccaatcgtcagccccagtgtctttgccagg
gtctcctactttgacaagtggattaaagataacaagaaatcatcatccaactcaaagcca
ggggagtcccctcaccatccaggatcccctgagaatgaaaatcccgagggcgacaataaa
aaccaaggtgctgttatcaagccgacggtgtgcacagccctgctgctctcccagatcctc
ctgcaacagttgatttag

DBGET integrated database retrieval system