KEGG   Mus musculus (house mouse): 217588
Entry
217588            CDS       T01002                                 
Symbol
Mbip, 4933408E06Rik
Name
(RefSeq) MAP3K12 binding inhibitory protein 1
  KO
K24538  MAP3K12-binding inhibitory protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    217588 (Mbip)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    ATAC complex
     217588 (Mbip)
SSDB
Other DBs
NCBI-GeneID: 217588
NCBI-ProteinID: NP_663417
MGI: 1918320
Ensembl: ENSMUSG00000021028
UniProt: Q99LQ1
Position
12:complement(56375091..56392681)
AA seq 341 aa
MAAAAELSSSSGSERSLEQCSSPLLTREVLCEVFRSLHTLTRQLNLRDDVVKITIDWNRL
QSLSASQPALLLTALEQHVLYLQPFLAKLQSLMKENSTATEIRQTEAETKSELRAIHPTE
DLQDEGKPKDCDVGDVKKTQNLFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREF
CNVIDCNQENSCARTDAVFTPYPGFKSHVKVSRVVNTYGPQTRPEGIAGSGHKPTGMLRD
CGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVNFSGKR
RKVQPPQQNYSLAELDEKISALKRALLRKSREADSMAAHLP
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggctgctgctgcggagcttagttcctcaagcggcagcgagaggagcctggagcaatgc
tccagccccctcctcacccgcgaggtcctctgcgaagtctttcgctccttgcacaccctg
acaagacagcttaacctcagagatgatgtggtgaaaattacaatcgattggaacaggctc
cagagcctctcagcatcccagcctgcactgctccttactgcacttgaacaacacgttttg
tatttacagccttttttagcaaaacttcagtctttaatgaaagaaaactcaacagctaca
gagataagacagacagaagcagagaccaagagtgaactaagagccatacatcccaccgag
gacctacaagatgaagggaagcccaaagactgtgatgtaggagatgtgaaaaagacacaa
aacctttttgacccagaagtagttcagatcaaggctggaaaagcagaaattgacagacga
atatctgcatttattgagagaaaacaagctgaaatcaatgaaaacaatgtcagggaattt
tgcaatgttattgattgtaatcaagaaaatagttgtgcaagaactgatgctgtctttact
ccttatcctggatttaaaagtcatgtaaaggtttctagagttgtgaatacatatggacca
cagactagacctgaaggaattgcagggtcaggtcacaaacctacaggcatgcttcgagat
tgtggtaatcaggcggtagaagaacgactccagaatattgaggctcacctgcgattgcag
acaggtggcccagtaccaagagacatctaccaaagaattaaaaagcttgaagataaaatc
cttgaattggagggcatctctcctgaatacttccaatctgtaaacttctctggaaaaaga
agaaaagtccaaccacctcaacagaactattcactggctgaactggatgagaaaattagt
gccctcaaacgagccctgctcagaaagtcaagagaagcagactccatggccgctcacctt
ccatga

DBGET integrated database retrieval system