KEGG   Mus musculus (house mouse): 217653
Entry
217653            CDS       T01002                                 
Symbol
Mis18bp1, 6720403H11, Knl2, mKIAA1903
Name
(RefSeq) MIS18 binding protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: SANTA Myb_DNA-binding Myb_DNA-bind_6 DUF2011
Other DBs
NCBI-GeneID: 217653
NCBI-ProteinID: NP_766166
MGI: 2145099
Ensembl: ENSMUSG00000047534
UniProt: Q80WQ8
Position
12:complement(65179508..65219354)
AA seq 998 aa
MIVTPLKHSGIHLSSGTLQRRNMPLDAVFIDSIPSGTLTPLKDLVKYQKSSLKVNGHKKN
QLLEIRTSNNKDLFQSTMLSEATLPNSSLDISVIKPSMDRLRNEMIYESPGKIFQRMKAK
VQRDKQEQLTRSSSMLGSPQGEHTKDFPPNTDKKAQLQQTYICEEKQTSVQSNDPSLGDP
PILNQEQKNVSASCISKKALTRAQFGGQVLHSKESPVRITVSKKNTFVLGGIDCTYEKFE
NTDVNTISSLCVPIKNHSQSITSDNDVTTERTAKEDITEPNEEMMSRRTILQDPIKNTSK
IKRSSPRPNLTLSGRSQRKCTKLETVVKEVKKYQAVHLQEWMIKVINNNTAICVEGKLVD
MTDVYWHSNVIIERIKHNELRTLSGNIYILKGLIDSVSMKEAGYPCYLTRKFMFGFPHNW
KEHIDKFLEQLRAEKKNKTRQETARVQEKQKSKKKDAEDKETYVLQKASITYDLNDNSLE
RTEVPTDPLNSLEQPTSGKERRHPLLSQKRAYVLITPLRNKKLIEQRCIDYSLSIEGISD
FFKAKHQEESDSDIHGTPSSTSKSQETFEHRVGFEGNTKEDCNECDIITARHIQIPCPKS
KQMLTNDFMKKNKLPSKLQKTENQIGVSQYCRSSSHLSSEENEVEIKSRTRARNTKERLN
RERENTNHITKDILLISETEGERACYITPKRPRSCYITPKRPRSSAKESHYKSAVSKDFL
TEGKASDRTSRQLLDHLPGLTDDEEWSEQELQKLHCAFTSLPKHKPGFWSDVAMAVGSRT
ADECQKKYTEEPQGQGSRKHGSKKKQANKVQNGEKDSADAKTIKITAKVGTLKRKRQMRD
CLEHLAKDNHDDFFTATPLQKQRIQLPSFQYSQDDDFLLDMDRDPASPSSIITSPLRSTT
PQCQHFSPSMLAAIERNNCDRYVYQMQKNAKKYGKSNGGLVWGNIRKKTVKTDLSSPPPT
RKALFNKDLGKNTDISKYFIDDTESDEEEKDYYFSNSD
NT seq 2997 nt   +upstreamnt  +downstreamnt
atgattgtaacacctttgaagcattcaggaattcatttgtcttctggaacattgcaaaga
agaaatatgcctctagatgcagtctttattgacagcatcccttcaggcacactcactcct
ttgaaagatttggtaaaatatcagaagtcctctctaaaagttaatggtcataaaaagaat
cagttattagaaataagaacttctaacaataaagatctatttcaatccaccatgttatca
gaggctacccttccaaacagctctcttgatatcagtgttataaagcccagcatggataga
ttaagaaatgaaatgatttatgaatcaccaggtaaaatctttcaaagaatgaaagcaaaa
gtacagcgtgacaaacaagaacaactgacaaggagcagtagcatgttgggatcaccacag
ggtgaacacaccaaagactttcctcctaacacggataagaaagctcagttgcaacaaacc
tatatctgtgaggaaaaacaaacgtcggtccaatccaatgacccttcattgggagatcct
ccaattctgaaccaagaacaaaaaaatgtttcagcttcgtgcatttcaaagaaggcatta
actagagcccagtttggcggacaagttcttcattcaaaagagagtcctgttaggatcact
gtgtccaaaaagaacacatttgttttgggaggcattgattgtacttatgaaaagtttgaa
aatactgatgttaacaccattagttctctttgtgttcctattaagaatcatagccaatct
attacttctgataatgatgtgacaacagaaaggactgcaaaagaggatattacagaacca
aatgaagagatgatgtccagaagaactattcttcaagatcccataaagaatacatctaaa
attaaacgttcaagtccaagacctaatttaacactatctggccggtctcaaagaaaatgt
acaaagcttgaaactgttgtaaaagaagtaaaaaaatatcaggcagtccacctacaggaa
tggatgattaaagtcatcaataataatactgctatatgtgtagaaggaaagctggtagat
atgactgatgtttattggcatagcaatgtaattatagagcggattaaacacaatgaactt
aggaccttatcaggcaacatttatatcttaaaaggattgatagactcggtctccatgaaa
gaagcaggatatccctgttatctcacaagaaaatttatgtttggatttccccacaactgg
aaggaacacattgataaatttctagaacaattaagggctgaaaaaaagaacaagaccaga
caggaaacagcaagagtccaagaaaaacaaaaatcaaaaaaaaaagatgcagaagataaa
gaaacttatgtcctccaaaaggccagcatcacgtatgaccttaatgataatagcttagag
agaactgaagtacccactgatcccttgaactcactggaacagcctacctccggcaaagaa
agaagacacccgcttctcagtcagaagagagcttatgttttaataacaccacttagaaac
aaaaagttgatagagcaaagatgtatagactacagtctctctattgaaggaatatcggac
tttttcaaagcaaagcatcaagaagaaagtgactcagatatacatggaactccaagttct
accagtaagtctcaagagacctttgaacatagagtgggatttgaaggcaataccaaggag
gactgcaatgaatgtgacataatcactgccagacatattcagataccttgcccgaaaagt
aaacaaatgctcaccaatgattttatgaaaaagaacaagttgccctcaaaactgcagaaa
actgaaaatcaaataggtgtatcacagtattgccggtcctcatcacatttgtcaagtgaa
gagaatgaagtagaaattaaaagtagaaccagagcaagaaatacaaaagaaaggctgaat
cgggagagagaaaacacaaaccacatcacaaaagatatcctcctcatttcagaaactgaa
ggtgagagagcttgttatatcacaccaaagagacctcgatcttgttatatcacaccaaag
agacctcgatcttctgctaaagagtcacattacaaatctgctgttagcaaggactttctc
actgaaggaaaggcatctgatagaactagcagacagctgttagaccatctacctggttta
actgatgatgaagaatggagtgagcaagagttacagaagctacattgtgcttttacatct
cttccaaagcacaaacctggcttttggtcagatgtggctatggcagtaggttctcgaact
gctgatgagtgccagaagaaatacacagaagaaccccaaggccaaggatcccgaaaacat
ggctctaagaaaaagcaagccaacaaggtccaaaatggtgagaaagacagtgctgatgcc
aagactattaagataactgccaaagtgggaactcttaaaaggaaacgacaaatgagggat
tgcctagaacatttggcaaaagacaaccatgatgattttttcactgcaacacccttgcag
aaacaaagaattcagttgccaagttttcaatacagtcaagatgatgattttctgctagat
atggacagggatccagcatctccatcatcaattattacttcaccattgagaagcactact
ccacaatgtcagcatttcagccccagcatgctagccgctatagaaaggaataattgtgat
agatatgtttaccaaatgcaaaaaaatgctaaaaaatatggcaagagtaatggtggcctt
gtctggggcaacattaggaaaaaaacagttaaaactgatctctcatctccaccaccaaca
cggaaagccctgtttaacaaagatttaggtaaaaacactgatatttcaaagtatttcatt
gatgatacagaatcagatgaagaagagaaagattattacttttccaattctgactga

DBGET integrated database retrieval system