KEGG   Mus musculus (mouse): 217666Help
Entry
217666            CDS       T01002                                 

Gene name
L2hgdh, BC016226
Definition
(RefSeq) L-2-hydroxyglutarate dehydrogenase
  KO
K00109  2-hydroxyglutarate dehydrogenase [EC:1.1.99.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    217666 (L2hgdh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.2  L-2-hydroxyglutarate dehydrogenase
     217666 (L2hgdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO Pyr_redox_2 FAD_binding_3 Mqo Thi4 Lycopene_cycl NAD_binding_8 FAD_binding_2 Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 217666
NCBI-ProteinID: NP_663418
MGI: 2384968
Ensembl: ENSMUSG00000020988
UniProt: Q91YP0
Position
12; 12 C2
AA seq 464 aa AA seqDB search
MWPTLRYVGGVCGLARYCVAGGFLRASGPASGVPGLLCGGGRRSSSTSSFDIVIVGGGIV
GLASARTLILKHPGLSIGVVEKEKDLALHQTGHNSGVIHSGIYYKPESLKAKLCVEGAAL
IYEYCNLKGIPYRQCGKLIVAVEQEEIPRLQALYERGLQNGVEGLRLIQQEDIKKKEPYC
RGLMAIDCPYTGIVNYQQVALSFAQDFQEAGGSILRDFEVKGIEIAKENSSRSKDGMNYP
IAVKNSKGKEIRCRYVVTCAGLYSDRISELSGCNPDPQIVPFRGDYLVLKPEKGYLVKGN
IYPVPDSRFPFLGVHFTPRLDGTIWLGPNAVLAFKREGYRPFDFDARDVMEVILKSGFIN
LVFQHFSYGVNEMYKACFLSETVKHLQKFIPEITISDVLRGPAGVRAQALDRDGNLVEDF
VFDGGTGEIADRVLHVRNAPSPAATSSLAISRMIAEEAQQRFKL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtggccgaccctgcgctacgtaggcggtgtctgcggactggcccggtactgcgtggct
gggggcttcctccgcgcaagtggaccggcgtccggggtgcccgggctactgtgcgggggt
ggccgcagaagctccagcaccagctcttttgatatagtcatcgttggaggtggaattgtg
ggccttgcctctgccagaacgctcatcctgaaacatcctggactttcgattggtgtggtg
gaaaaggagaaagatttagctcttcaccagactggacacaacagcggtgtcatacacagt
ggtatttactataaaccagaatctctgaaggctaaattgtgtgtagaaggcgcagccctc
atctatgagtactgcaacctcaagggaattccctacaggcaatgtggcaagctaatagta
gctgttgaacaagaagaaattcccagacttcaggccttgtatgagagaggcctgcagaat
ggagtcgaaggcctgaggctgatccagcaggaggatataaaaaagaaggagccgtattgc
aggggtctaatggctattgattgtccatacaccggcattgtgaactaccaacaggtagct
ttgtcatttgcccaggatttccaagaagcaggtggctctatcttgagagattttgaggta
aaaggtattgaaatagctaaagaaaactcttcaagaagtaaagatggcatgaactatcca
atcgctgtcaagaacagcaagggaaaggagattcggtgtcgatatgttgtcacatgtgct
ggtctttactctgaccgtatttcagagttgagtggctgcaatcctgaccctcaaattgtc
ccattccggggagattacctggtcttaaagccagaaaagggctaccttgtaaaaggaaat
atttatccggtcccagacagccggtttcctttccttggagttcactttacgcccaggttg
gatggcactatttggctagggcctaatgcagtgcttgcctttaaacgggaaggttacaga
ccctttgacttcgatgccagagatgttatggaagtaattctcaaaagcggcttcattaac
ctggtgttccagcatttctcttatggagttaatgaaatgtataaagcctgttttctcagt
gaaacagtgaagcatcttcaaaagttcattcctgaaatcaccatcagcgatgtccttcga
ggtcctgctggagtacgggcccaggccctggacagagatggaaatctggtagaggatttt
gtgtttgacggagggactggcgagattgcagaccgcgtccttcatgtgagaaatgcgcct
tcgcctgctgccacttcctccctggcaatttctagaatgatagcagaggaagcacagcaa
aggtttaagttatga

DBGET integrated database retrieval system