KEGG   Mus musculus (mouse): 217682
Entry
217682            CDS       T01002                                 

Gene name
Plekhd1, 3830431G21Rik
Definition
(RefSeq) pleckstrin homology domain containing, family D (with coiled-coil domains) member 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PH
Other DBs
NCBI-GeneID: 217682
NCBI-ProteinID: NP_001170974
MGI: 3036228
Ensembl: ENSMUSG00000066438
Vega: OTTMUSG00000033011
UniProt: B2RPU2
Position
12; 12 C3
AA seq 505 aa
MFTSKSNSVSPSPSLEQADADALDISTKVQLYGVLWKRPFGRSSAKWSRRFFIIKESFLL
YYSESERKSFETNKYFNIHPKGVIPLGGCLVEAREEPSMPYAMKISHQDFHGNVLLAAES
EFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQ
REQREELERLNQVLEAEKQQFEEVVQELRVEQEQIKRELELTARCLKGVEQEKKELRHLT
ESLQHTLEELSIEKKKTLEMLEEDKNQPQPLTNQSEQPPASDGLHSNLRQIEERMQELLA
EKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQELTAEKQQAERELKAEVKVRMD
LERRLREAEAALRSLEQGLNSKVRNKEKEERMRADVSHLKRFFEECIRNAELEAKMPVIM
KNSVYIHKAATRRIKSCRFHRRRSSTSWNDMKPSQSFMTSQLEANNIEELKEVAKRLSRD
QRFRESIYHIMATQPGASALPRGGK
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgttcacatccaagtccaactccgtgtcgccatcgccgtccctggagcaggcggacgcg
gacgcgctggacatcagcaccaaagtgcagctctacggggttctgtggaaacggccgttc
gggagatcctcggccaagtggtcccggcggtttttcatcatcaaagaaagctttctgctt
tactactctgagagtgagagaaagagctttgaaaccaataagtacttcaatattcatcct
aagggtgtcattccactgggtggctgcctggtggaggccagagaagagcccagtatgccc
tatgccatgaagatctcacaccaggacttccatgggaatgtcttgttggctgcggagtct
gagtttgagcagacacaatggctggagatgttgcaggagtctgggaaggtgacctggaaa
aatgcccagctaggggaagctatgatcaaaagcctggaggcacaggggctacagctggct
aaggaaaagcaggaatatttagacaagctgatggaggagacagaagaactgtgccttcag
agggaacagagagaggagcttgagcgcctgaaccaagtgctggaggccgagaaacagcag
tttgaggaggtggtgcaagagctgagagtggagcaggagcagatcaaaagggagctagaa
ctcactgcaagatgcctcaagggcgtggaacaagagaagaaggagctgagacacctcaca
gagtccttacagcatacgctggaggaactctccatagagaagaagaaaaccctagagatg
ctggaggaagataagaaccagccacagcccttgaccaaccagagtgagcagccaccggcc
agtgatggtctccatagcaacctcaggcagatcgaagagcggatgcaggagctattggcg
gagaagcttctggctgagaagcggatgaaggagaatgaggaacgctctcgggctctggag
gaggaacgggaattctactcaagccagtcccaagccctgcagaactcgctgcaggagctc
actgcagagaagcagcaggcggagcgggaactcaaggctgaagtgaaagtacgcatggac
cttgagaggcggcttcgggaggcagaggcggccttgcggagcctggaacaaggcctcaat
tccaaggttcggaacaaggagaaggaagaacggatgcgggcggacgtgagccacctgaaa
aggttcttcgaggagtgcatccggaatgcagagctggaggccaagatgccggtcatcatg
aagaactccgtgtacatccataaggcagccactcgccgcatcaaaagctgccgattccac
cgccgccggtccagtacttcctggaatgacatgaagccatcccagtccttcatgacctcc
cagctagaagccaacaacatagaggagctgaaggaggtagccaagcggctaagcagagac
cagcgcttccgggaatccatctatcacatcatggctacccagcctggggcctctgcactt
ccccggggaggaaagtaa

DBGET integrated database retrieval system