KEGG   Mus musculus (mouse): 21769
Entry
21769             CDS       T01002                                 

Symbol
Zfand3, AW539211, TEG-27, Tex27
Name
(RefSeq) zinc finger, AN1-type domain 3
  KO
K24686  AN1-type zinc finger protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21769 (Zfand3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  AN1-type zinc finger domain-containing proteins
   21769 (Zfand3)
SSDB
Motif
Pfam: zf-AN1 zf-A20 Nucleo_P87
Other DBs
NCBI-GeneID: 21769
NCBI-ProteinID: NP_683728
MGI: 1096572
Ensembl: ENSMUSG00000044477
UniProt: Q497H0
Position
17; 17 A3.3
AA seq 205 aa
MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSTPSTSNSQSDLF
SEETTSDNNNTSVTTPTLSPSQQSLPTELNVTSPSTEEYSQSENEASPVKRPRLVENPER
PEESGRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGRE
EAIMKMVKLDRKVGRSCQRIGEGCS
NT seq 618 nt   +upstreamnt  +downstreamnt
atgggagacgccgggagcgagcgcagcaaagcgcccagcctgccgcctcgctgtccctgc
ggcttctgggggtccagcaagactatgaatctctgttccaaatgctttgctgattttcaa
aagaaacaaccagatgatgattccaccccaagtacaagtaacagccaatcagatttgttt
tccgaagagaccaccagtgacaacaacaatacctctgtaaccacgccaactcttagtccc
agccagcagtcgctcccgacagaactgaatgtaacttcaccgagtacagaggaatattca
cagtccgagaacgaggcctcacccgtgaagcgaccgcgactagtagagaaccccgagcgg
cctgaggagagcggccggtcgaagcagaagagccggcgccgctgcttccagtgccagacc
aagctggagctggtgcagcaggaactgggatcctgtcgctgtggctacgtgttctgtatg
ttacatcgcctcccagagcagcacgactgtacgttcgaccacatgggccgtggccgcgag
gaagccatcatgaaaatggtgaaactggaccggaaagtggggcgctcctgccagcgcatc
ggggaggggtgctcctga

DBGET integrated database retrieval system