KEGG   Mus musculus (mouse): 217716
Entry
217716            CDS       T01002                                 

Gene name
Mlh3, AV125803, BB126472
Definition
(RefSeq) mutL homolog 3
  KO
K08739  DNA mismatch repair protein MLH3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    217716 (Mlh3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    217716 (Mlh3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     217716 (Mlh3)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 217716
NCBI-ProteinID: NP_001291404
MGI: 1353455
Ensembl: ENSMUSG00000021245
UniProt: Q68FG1 Q3V1X3
Position
12; 12 D1
AA seq 1411 aa
MIRCLSDDVKTKLRSGLAISSLGQCVEELTLNSIDAEATCVAIRVNMETFQVQVIDNGLG
MAGDDVEKVGNRYFTSKCHSVRDLENPAFYGFRGEALASIADMAGAVEISSKKNTTLKTF
VKMFQNGKALATHEADLTRPSVGTTVTVYNLFYQFPVRRKSMDPRLEFEKVRQRVEALSL
MHPSISFSLRNDVSGSMVLQLPKTKDICSRFCQIYGLGKSQKLREIRFKYKEFEFSGYIS
SEAHYNKNMQFLFVNRRLVLRTKLHKLIDFLLRKESIICRPKNGSASRQMNSSPRHRSAS
ELHGIYVINVQCPFCEYDVCIEPAKTLIEFQSWDTVLICIQEGVKRFLKQEKLFVELSGE
DIKEFNEDNGFSLFGTTLQTHVSTHEKCDQSSFREACNKILDSYEMFNLQSKAVKRIATL
ENKTRQNPGDSETIRKKTVGSLYTDASDGPCYSKSVESVLQDSNNSAYLEPRVSEEEVAK
TSHSGENEKWKKSFLENKTSGRIHETSPKMFSSPIQMHHLLEEREADLEMQTISSTVNVM
AANIPQNNDIPSQLEKWKDAPEVGCQPLPFETTLLRVRGTQRKKERRKKEPSSRGRVNVF
SYGQVKLCSTGFITHVVQSEHAKSTETEHSFKNYARPGPVSAQETFGKRTHHAIETPDSS
DLTSTLSKESSQPPNKRFCRTNTGYGTENKPVATDDNLALFQESCKESHTDRLLPDASSF
PWCRYVSDGCRKIDKRGSFKQVVRRKLSLRSQVGSLEKFKRQYGKVSSSLDTEKDNNTEV
RTHLDPQNEPDVLLKDKSHLDMSDGCEITTVEHSETCQPLSPILYPEKILFSKEDRLEQM
PHLRESPITLEELSHCNRKADVEKSAASLASKLSKLKDSEKEMQTVGMTGHTSELPDSNP
SWKDNSQCTRLDLDFCELLKNKLEKIESDMLPMADSATEDGPINKNSELHPNNTTDDTEK
PETPLLFPCNDSKISRDSDVLIRTSEQPTGNPDSVGKVIMSQVEDGIGSQGGVCPQGDES
KARSCSKNEPNAHCMDWQQHFDVTLGRMVYINRMTGLSTFVAPTDDLHTACTKDLTTVAV
DVLLGNDAVDAAAAAVSEPLQSLFSEWSNPVFARYPEVAVDVSSGQAESLAVKIHNVLYP
YRFTKEMIHSVKVLQQVDNKFIACLMSTRMDEDGRTGGNLLVLVDQHAAHERIRLEQLIT
DSYEKQDPQSAGRKKLLSSTIIPPLAITVSEEQRRLLRSYHKHLEDLGLELLFPDASDSL
ILVGKVPLCFVEREASELRRGRSTVTKSIVEELIREQVELLQTTGGIQGTLPLTVQKVLA
SQACHGAIKFNDRLSLEESCRLIEALSLSQLPFQCAHGRPSMLPLADLDHLEQEKQVKPN
LAKLRKMVRAWHLFGKTEQNLQQPIRPCEPP
NT seq 4236 nt   +upstreamnt  +downstreamnt
atgatcaggtgtctatcagatgacgtaaaaaccaagttgcgttccggtttagccataagc
tccttgggccagtgtgttgaagaacttacccttaacagtattgatgctgaagcaacatgt
gtggccatcagagtgaatatggaaaccttccaagttcaagtgatagacaatggacttggg
atggcgggggacgatgtagagaaggtgggaaaccggtattttactagtaaatgccactca
gtgcgggacttggagaacccagcattttatggcttccgaggagaggccttggcaagtata
gccgacatggctggtgctgtggagatttcatccaagaaaaacacaacactgaaaaccttt
gtgaaaatgtttcagaatggaaaagcccttgccacccatgaggctgatttgaccagacca
agtgtggggactacagtaacggtctataacctgttttaccagtttcctgtgcggaggaaa
agcatggatcctagactagagtttgagaaagttcggcagagggtagaagctctctcactt
atgcacccctccatttctttctctttgaggaacgatgtatctggatccatggttcttcag
ctccctaaaaccaaagacatatgctctcgattctgtcaaatttacggattgggcaagtcc
caaaagttaagagaaatacgttttaaatacaaggaatttgagttcagtggctacatcagc
tctgaagcacactacaataagaatatgcagtttttgtttgtgaacagaagactagtttta
agaacaaagttgcataaacttattgactttttattaagaaaagaaagcattatatgcagg
ccaaagaatggctctgccagtaggcaaatgaattcaagtcctcgacaccgttctgcctca
gaactccacgggatatatgtaatcaatgtgcagtgccctttctgtgagtatgatgtctgc
atagagccagccaaaactctgattgagtttcagagctgggataccgtgttgatttgtatt
caggaaggagtaaaaaggtttttaaagcaagaaaaattatttgtagaattatcaggtgaa
gatattaaggaatttaatgaagataatggttttagtttgtttggcacgactcttcagaca
catgtgtctactcatgagaagtgtgaccagagcagtttccgggaagcgtgtaataaaatt
ctggattcctatgaaatgtttaatttgcagtcaaaagctgtgaaaagaatagctactcta
gaaaataaaaccagacaaaaccctggtgattcagaaactatcagaaaaaagacagtgggc
tcattgtacacagatgcatcggatggcccgtgctatagtaaatcggtagagtctgtttta
caggacagcaacaacagtgcttacttagaaccgagggtgtcagaagaagaggtagccaaa
acatcacactccggagaaaatgagaaatggaaaaaatcttttttggaaaataagacttca
ggaaggatacatgaaaccagtccaaaaatgttttcaagccccatccaaatgcatcacctc
cttgaggagagagaggcagatctggaaatgcagacaataagtagtactgttaatgtcatg
gctgccaacattccccaaaataatgacattccgagtcaactggagaaatggaaagatgct
cctgaagtggggtgccaacctctgccttttgagacaaccttattaagggtacggggtact
cagaggaagaaggaaagaaggaaaaaggagcccagtagtcgtggaagagtaaatgttttt
agttatggacaagttaaattatgctccactggctttataactcatgtagtacaaagtgag
cacgctaaatcaactgaaacagaacattcatttaaaaattatgctcgacctggtcctgta
agtgcccaagaaacatttggaaaaagaacacaccatgcaattgagactccagacagcagt
gatttaacaagcactttaagtaaagaatccagtcaaccgcccaacaaaaggttttgcaga
acaaatacaggttacgggacagagaacaaacctgtagcaacagatgacaacttggctctt
tttcaggaaagctgtaaagaatcacacacagatcgccttttgcctgatgcatcctccttc
ccatggtgtagatatgtttccgatggttgtaggaaaatagataaaaggggttccttcaaa
caggtagtccgtaggaagctaagcttgcgttcacaagtagggtctttagagaagtttaag
aggcagtatgggaaggtcagcagttccctagatacagaaaaggataataacactgaagtc
aggactcatcttgatcctcaaaatgaacccgatgttcttctgaaagacaagagccactta
gatatgtctgatggttgtgagatcactactgtggagcacagtgagacttgtcaaccatta
agtcccatcctgtacccagaaaaaattttattttccaaagaagatcgcttagaacagatg
cctcatttgagagaaagtcctataactctggaagaattatctcactgtaacagaaaagct
gatgttgagaagtccgctgcatcactggcttctaaattatccaaactaaaggattctgaa
aaagagatgcaaaccgtggggatgacaggtcatactagtgaacttccagattcaaatccc
agttggaaagataatagccagtgcactaggttagacttggatttttgtgaattattaaaa
aacaaacttgaaaaaatagagagtgatatgcttccaatggcagattctgccacagaggat
ggtcccatcaataaaaacagtgaactacatcctaacaatacaacggatgacacagagaaa
ccagaaactcctttgctgttcccctgtaatgattctaaaatcagcagagattcagatgtt
cttatcagaacttcagaacaacctacaggaaaccctgactctgtcggtaaagtgataatg
agtcaggtagaggatggcattggcagccaaggtggagtctgtccccagggtgatgaatct
aaggcaagatcttgttccaaaaatgaaccaaacgcacactgtatggattggcagcagcat
tttgatgtaaccctgggaagaatggtttacatcaacagaatgacaggacttagcacattc
gttgctccaactgacgaccttcatactgcttgtactaaagatctgacaactgtggctgtg
gatgtcctgcttgggaatgatgctgtggatgctgctgctgctgctgtcagtgaacccctt
cagtctctgttttcagaatggagcaatccagtgtttgctcgatacccagaggttgctgtt
gatgtcagcagtggccaggctgagagcttagccgttaaaattcacaacgtcctgtatccc
tatcgcttcaccaaagagatgattcactcagtgaaggttctccagcaagtggataacaag
tttattgcctgcttaatgagcacgaggatggatgaggatggccgaacaggtggaaacctg
ttagtcctggtggaccagcatgctgcccatgaacgcattcgtttggagcagcttattact
gattcctatgagaaacaagatccacaaagcgctggccggaagaaattattgtcttccaca
ataatccctccactggcaatcaccgtgtcagaggaacaaaggagactcttacggtcttac
cacaaacatttagaagatctggggcttgagttgctctttccagatgctagtgattctctg
atcctggtgggaaaagtgccgctctgctttgtagagagagaagctagtgagcttcgaaga
ggacgctctactgtgactaagagtattgtggaggaattaattcgagaacaagtggagctg
ctccagaccacaggaggtatccaagggacactgccactgactgtccagaaggtgttggcc
tcccaggcctgccatggggctattaagtttaatgatcgtctgagcctagaagagagctgc
cgcctcatcgaagctctgtccttgtcccagctgccatttcagtgtgctcatgggagaccc
tcaatgctgcccttagctgacctggaccacttggagcaggaaaaacaggttaaacccaac
cttgctaaacttcgcaaaatggttcgtgcctggcatctctttggaaaaacagagcagaac
ctgcagcagcctatacgtccttgtgagcctccatga

DBGET integrated database retrieval system