KEGG   Mus musculus (mouse): 217779Help
Entry
217779            CDS       T01002                                 

Gene name
Lysmd1, 2610022K04Rik, AI415311
Definition
(RefSeq) LysM, putative peptidoglycan-binding, domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LysM GyrB_insert
Motif
Other DBs
NCBI-GeneID: 217779
NCBI-ProteinID: NP_694761
MGI: 1919409
Ensembl: ENSMUSG00000053769
Vega: OTTMUSG00000022307
UniProt: Q9D0E3 A6H624
Position
3; 3 F2.1
AA seq 226 aa AA seqDB search
MASPSRQPPLGGSGLLHGSRARSYGSLVQSSCSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRTNRLYTNDSIFLKKTLYIPILSEPRDLFNGLDSEEENDGEEEVRPSKDEIGSSS
GRRKNRGSGSGRPNGTGLPPHQETSTPSHDLSASDFLKKLDSQISLSKKAAAQKLRKGES
GVPEEDTGLYPSSPRMQQRAVLGPVPLTRTSRTQTLRDQEDEIFKL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccctctagacagcctcccctcggggggtcagggctgctgcatgggagccgt
gctcgttcttatggaagcctggtacaatcatcctgctccccagtgagggaaagacgcctg
gagcatcaattggagcctggagacaccctggctggattagcactcaaatacggggtaacg
atggaacagattaagcgtacaaaccgcctttatactaacgactccatcttcctgaagaaa
acgctctacatccccatcctatcagagcccagagacttgtttaatggtttggattctgag
gaggaaaatgatggagaggaagaggtgcgcccgagtaaggatgagatcggatcatcttcg
gggaggaggaagaatcgagggtcagggtcgggtcggcccaatggcacaggcctcccgcct
caccaggaaacctccacccccagccatgacctttctgcctctgatttccttaagaagctt
gactcacagatcagcctgtcaaagaaggctgctgcccagaagctgaggaaaggggagagt
ggggtacctgaggaggacacgggtctctaccctagctcccctcggatgcagcagcgagca
gtcctaggccctgtgccactcacccggacgtctcggacccagacactgcgggaccaggaa
gatgaaatcttcaaactctga

DBGET integrated database retrieval system