KEGG   Mus musculus (mouse): 21785Help
Entry
21785             CDS       T01002                                 

Gene name
Tff2, SP, mSP
Definition
(RefSeq) trefoil factor 2 (spasmolytic protein 1)
  KO
K22453  trefoil factor 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    21785 (Tff2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trefoil TEX29
Motif
Other DBs
NCBI-GeneID: 21785
NCBI-ProteinID: NP_033389
MGI: 1306805
Ensembl: ENSMUSG00000024028
Vega: OTTMUSG00000020098
UniProt: Q9QX97
Position
17 A3.3; 17 15.8 cM
AA seq 129 aa AA seqDB search
MRPRGAPLLAVVLVLGLHALVEGEKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFD
SSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFF
PQSVEDCHY
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgacctcgaggtgcccccctgctggcagtggtcctggttttgggactgcatgctctg
gtagagggcgagaaaccttccccctgtcggtgctccaggctgacaccccacaacagaaag
aactgtggcttcccgggcatcaccagtgagcagtgctttgatcttggatgctgctttgac
tctagcgtcgctggggtcccttggtgtttccacccacttccaaaccaagaatcggagcag
tgtgtcatggaagtgtcagctcgcaagaattgtgggtacccgggcatcagtcccgaggac
tgtgccagtcgaaactgctgcttttccaacctgatctttgaagtgccctggtgtttcttc
ccacagtctgtggaagattgtcactactga

DBGET integrated database retrieval system