KEGG   Mus musculus (mouse): 217946
Entry
217946            CDS       T01002                                 

Gene name
Cdca7l, BC006933, JP, JPO2
Definition
(RefSeq) cell division cycle associated 7 like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-4CXXC_R1
Other DBs
NCBI-GeneID: 217946
NCBI-ProteinID: NP_666152
MGI: 2384982
Ensembl: ENSMUSG00000021175
Vega: OTTMUSG00000040128
UniProt: Q922M5
Position
12; 12 F2
AA seq 438 aa
MELATRSQIPKEVADIFSAPSDDEEFVGFQDDVPMQNLSESCGSLDSRELEKQQNVCFRS
KYFTEELRRIFKEDTDSEMEDFEGFTESELNMSSNPELMESELSDSDKAYPVMNDAEEDD
EEEAAPRRGRSTRRSSFGLRVAFQFPTKKLARTPDKDSSHLLDSKTDLRRKKSSRQPKGK
EDSASDAEDESRAESQENSDALLKRAMNIKENKAMLAQLLAELNSVPDFFPVRTPPSASR
RRTPRRAFSEGQITRRMNPTRSARPPEKFALENFTFSATKLTEELYSFRRRKTISGGKCQ
TYRRHRISSFRSVKDITEEDLENIAITVRDKVYDKVLGNTCHQCRQKTIDTKTVCRNQSC
GGVRGQFCGPCLRNRYGEDVRTALLDPKWTCPPCRGICNCSYCRRRDGRCATGILIHLAK
FYGYDNVKEYLESLQKQL
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggagctggccacgcgctcccagatccccaaagaagtagctgacatcttcagtgctccc
agtgacgatgaagagtttgtgggtttccaggatgatgttcccatgcaaaacctgtcagag
agctgtggtagtttggactcacgggagttggagaaacagcagaatgtgtgcttccgttcc
aaatacttcacagaagaactaagaaggattttcaaagaggacacggactcagaaatggaa
gattttgaaggatttacagagagcgagctgaacatgagcagtaacccagagctcatggag
tcggagctgagtgacagtgacaaagcataccctgtgatgaatgatgcggaggaagatgat
gaagaggaggctgcacctagaaggggcaggtccacaagaagaagcagtttcggtcttcgg
gtagcctttcagttccccaccaaaaaattggcaagaacaccagataaagatagctcacac
ttgctggacagtaagacggatcttagaagaaagaagagctccagacagcccaagggaaag
gaggactctgcttctgatgccgaggatgagtccagagctgagagccaagagaattcggat
gctctgctgaaaagggccatgaacatcaaagagaacaaggctatgcttgctcagttgttg
gcggaattgaattcggtgccagatttcttccctgttcggacaccaccttcggcttctagg
aggcgaacaccacgacgggccttctcagagggacagatcacacggcgcatgaacccaacc
cggagtgcacgaccccctgaaaagtttgctctggagaacttcaccttctcagccaccaag
cttactgaagagctttacagtttcagaagaagaaagacaatcagtggggggaaatgccag
acgtatagacgtcatcggatatcttctttccgctcagtgaaagacatcactgaggaagac
ttggaaaacattgccataactgtgcgtgataaagtctatgataaagtgcttggtaacacg
tgccatcagtgccggcagaagaccatcgataccaagacggtctgtcggaaccagagctgt
ggtggtgtgcggggacagttctgtgggccctgcctgcggaatcgctatggggaggatgtg
cggacagcgttgctggatccgaagtggacatgtcctccctgccgtggcatctgcaattgc
agttactgccggaggcgagatggccgctgtgctactggaattctcattcatctggccaag
ttctacggttatgataatgtcaaggagtacctggagagcttacagaagcagctgtag

DBGET integrated database retrieval system