KEGG   Mus musculus (mouse): 218038
Entry
218038            CDS       T01002                                 

Gene name
Amph
Definition
(RefSeq) amphiphysin
  KO
K12562  amphiphysin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    218038 (Amph)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    218038 (Amph)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    218038 (Amph)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    218038 (Amph)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    218038 (Amph)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    218038 (Amph)
SSDB
Motif
Pfam: BAR SH3_9 SH3_1 SH3_2 HD_3 ATG17_like THP2 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 218038
NCBI-ProteinID: NP_778172
MGI: 103574
Ensembl: ENSMUSG00000021314
Vega: OTTMUSG00000054291
UniProt: Q7TQF7
Position
13 A2; 13 6.89 cM
AA seq 686 aa
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLT
LDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVF
EEFNVDLQEELPSLWSSRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHAD
KAFSIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPVRPRSPSQTRKG
PPVPPLPKVTPTKELKQENIINFFEDNFVPEINVTTPSQNEVLEVKKEETLLDLDFDPFK
PDVAPAGSAAATHSPMSQTLPWDLWTTSTDLVQPASGGSFNDFTQAQDTSLFTMQTDQNM
AETEQALPTEPQAEEPPATAAAPTAGLDLGLEMEEPKEEAVIPPATDTGETVETAVPTEG
APVEEAEAEKAALPAGEGGSPEGAKIDGESTELAISESPQPVEPEAGAPQVIPSVVIEPA
SNHEGEGEHQETATGTEPREAAEDVAAQGSAGEKQEVATEPTPLDSQATLPASAGAVDAS
LSAGDATQELPPGFLYKVETLHDFEAANSDELNLQRGDVVLVVPSDSEADQDAGWLVGVK
ESDWLQYRDLATYKGLFPENFTRRLE
NT seq 2061 nt   +upstreamnt  +downstreamnt
atggccgacatcaagacgggcatcttcgccaaaaacgtgcaaaagcgcctcaaccgcgcg
caggaaaaggtcctccagaagctggggaaggctgacgagacaaaagatgaacagtttgaa
gaatatgtccagaacttcaaacggcaggaggcagagggtaccagacttcagcgagaactc
cggggatatttagcagcaatcaaaggtatgcaggaggcctcaatgaagctcactgaatct
ctacatgaagtctacgagccagactggtatggacgggaagatgtaaagatggttggtgag
aagtgtgatgtgctgtgggaagacttccatcaaaagctagtggatggctccttgctgaca
ctggacacctacctgggccagtttcctgacataaagaatcgcatcgctaagcgcagcagg
aagcttgtggattatgatagtgctcgccatcacctggaggctctgcagagttccaaacgg
aaagatgagagtcggatctctaaggcagaagaggagtttcagaaagcacagaaagtgttt
gaagagttcaatgttgacttacaagaagagttgccgtcattgtggtcaagtcgagttggc
ttttacgtcaatactttcaaaaatgtctccagccttgaggccaagtttcataaggaaatc
gcagtgctttgccacaagctctatgaagtgatgacgaaactcggtgatcagcatgctgac
aaggccttcagcattcaaggagctcccagtgactcgggtcctcttcgcattgcaaagaca
ccatcacctccagaggagccttctcccctgcccagccccacggctagtcccaaccacaca
ttagcacctgcatctcctgccccagtgcgacccagatcaccttcacagacaaggaaaggg
cctcctgtcccacctctgcctaaagtcaccccaacaaaggaactgaaacaggagaacatc
atcaatttctttgaggacaactttgtaccagaaatcaatgtgacaacaccttcccagaac
gaagtcttggaggtgaagaaggaagagactttgctggatttggactttgaccctttcaag
cccgatgtggctccggcaggttctgctgcagcgacccactctcccatgtctcagacattg
ccctgggacttatggacgacaagcactgatttggtacaaccagcttctgggggttcattt
aatgatttcacccaggcccaggacacttcattattcaccatgcagacagatcagaatatg
gctgaaactgagcaggctctacctacagagccccaagccgaagagcctcctgccactgct
gctgcacctactgctgggctggaccttgggctagagatggaggagccaaaggaggaggct
gtgatccctcccgcaactgatactggcgagactgtggaaactgcagtgccaactgagggt
gccccggtggaggaagcagaggcagagaaggcagccctccctgctggagaaggaggaagt
ccagagggagccaaaattgacggggaaagcacggagcttgcaatcagtgagagccctcaa
ccagtggagcccgaagcgggtgctcctcaggtcatcccttctgttgtcattgagccagcc
tccaaccatgaaggagaaggagaacaccaagaaactgctacgggtactgaaccgagggag
gccgctgaggatgtggctgcccagggctcagcgggtgagaagcaggaagtggctacagag
cccacgcctctggattctcaggcaactctgcctgcatctgcaggtgctgtggatgcctcg
ctgtctgcaggggatgccactcaggaactgcctcctggctttctctacaaggtggaaacc
ctgcatgatttcgaggcagcgaactctgatgaacttaacctacaaaggggtgacgtggta
ctcgtggtgccttcagactcagaagccgaccaggatgcaggctggttggtgggggtgaag
gagtcagactggcttcagtacagagacctggccacgtacaaaggcctctttccagagaac
ttcacgcggcgcctggagtag

KEGG   Mus musculus (mouse): 30948
Entry
30948             CDS       T01002                                 

Gene name
Bin1, ALP-1, Am, Amphl, BRAMP-2, SH3P9
Definition
(RefSeq) bridging integrator 1
  KO
K12562  amphiphysin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    30948 (Bin1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    30948 (Bin1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    30948 (Bin1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    30948 (Bin1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    30948 (Bin1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    30948 (Bin1)
SSDB
Motif
Pfam: BAR SH3_9 SH3_1 SH3_2 THP2
Other DBs
NCBI-GeneID: 30948
NCBI-ProteinID: NP_033798
MGI: 108092
Ensembl: ENSMUSG00000024381
UniProt: O08539
Position
18 B1; 18 18.01 cM
AA seq 588 aa
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTR
LQKDLRTYLASVKAMHEASKKLSECLQEVYEPEWPGRDEANKIAENNDLLWMDYHQKLVD
QALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK
AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVN
TFQSIAGLEENFHKEMSKLNQNLNDVLVSLEKQHGSNTFTVKAQPSDNAPEKGNKSPSPP
PDGSPAATPEIRVNHEPEPASGASPGATIPKSPSQLRKGPPVPPPPKHTPSKEMKQEQIL
SLFDDAFVPEISVTTPSQFEAPGPFSEQASLLDLDFEPLPPVASPVKAPTPSGQSIPWDL
WEPTESQAGILPSGEPSSAEGSFAVAWPSQTAEPGPAQPAEASEVVGGAQEPGETAASEA
TSSSLPAVVVETFSATVNGAVEGSAGTGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGD
VVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVQ
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcagagatggggagcaagggggtgacggcggggaagatcgccagcaacgtacagaag
aagctgacccgagcgcaggagaaggtcctgcagaaactggggaaggcggacgagacgaag
gacgagcagtttgagcagtgtgtccagaacttcaataagcagctgacagagggtacccgg
ctgcagaaggatcttcggacctatctggcttctgttaaagcgatgcacgaagcctccaag
aagctgagtgagtgtcttcaggaggtgtatgagcccgagtggcctggcagggatgaagca
aacaagattgcagagaacaatgacctactctggatggactaccaccagaagctggtggac
caggctctgctgaccatggacacctacctaggccagttccctgatatcaagtcgcgcatt
gccaagcgggggcggaagctggtggactatgacagtgcccggcaccactatgagtctctt
caaaccgccaaaaagaaggatgaagccaaaattgccaagcctgtctcgctgcttgagaaa
gccgccccccagtggtgccaaggcaaactacaggctcatcttgtagctcaaactaacctg
ctccgaaatcaggcagaagaggagctcatcaaagcccagaaggtgttcgaggagatgaac
gtggatctgcaggaggagctgccatccctgtggaacagccgtgtaggtttctatgtcaac
acgttccagagcatcgcgggtctggaggaaaacttccataaagagatgagtaagctcaat
cagaacctcaatgatgtcctggtcagcctagagaagcagcacgggagcaacaccttcaca
gtcaaggcccaacccagtgacaatgcccctgagaaagggaacaagagcccgtcacctcct
ccagatggctcccctgctgctacccctgagatcagagtgaaccatgagccagagccggcc
agtggggcctcacccggggctaccatccccaagtccccatctcagctccggaaaggccca
cctgtccctccgcctcccaaacacaccccatccaaggagatgaagcaggagcagattctc
agcctttttgatgacgcatttgtccctgagatcagcgtgaccaccccctcccagtttgag
gcccctgggcctttctcagagcaggccagtctactagacctggacttcgagccccttcca
ccagtggcgagccccgtgaaggcacccacaccctctggtcagtcaatcccatgggacctc
tgggagcccacagagagtcaagctggcatcctgccttccggggagcccagttctgctgag
ggcagctttgctgtggcctggcccagccagacagccgagccagggcccgcccaaccagca
gaggcctccgaggtggtgggtggagcccaggagccaggggagacagcagccagtgaagca
acctccagctctcttccggctgtggtggtggagaccttctccgcaactgtgaatggggcg
gtggagggcagcgctgggactggacgcttggacctgcccccgggattcatgttcaaggtt
caagcccagcatgattacacggccactgacactgatgagctgcaactcaaagctggcgat
gtggtgttggtgattcctttccagaacccagaggagcaggatgaaggctggctcatgggt
gtgaaggagagcgactggaatcagcacaaggaactggagaaatgccgcggcgtcttcccg
gagaattttacagagcgggtgcagtga

DBGET integrated database retrieval system