KEGG   Mus musculus (mouse): 21804
Entry
21804             CDS       T01002                                 

Symbol
Tgfb1i1, AR, ARA55, Hic5, TSC-, TSC-5, hic-, hic-5
Name
(RefSeq) transforming growth factor beta 1 induced transcript 1
  KO
K24315  transforming growth factor beta-1-induced transcript 1 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21804 (Tgfb1i1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 LIM domain-containing proteins
  Paxillin family proteins
   21804 (Tgfb1i1)
SSDB
Motif
Pfam: LIM Paxillin
Other DBs
NCBI-GeneID: 21804
NCBI-ProteinID: NP_001276479
MGI: 102784
Ensembl: ENSMUSG00000030782
Vega: OTTMUSG00000036582
UniProt: Q62219
Position
7; 7 F3
AA seq 461 aa
MEDLDALLSDLETTTSHMSRLGAPKERPPETLTPPPPYGHQPQTGSGESSGTTGDKDHLY
STVCKPRSPKPVAPVAPPFSSSSGVLGNGLCELDRLLQELNATQFNITDEIMSQFPSSKM
AEGEEKEDQSEDKSSPTVPPSPFPAPSKPSATSATQELDRLMASLSDFRVQNHLPASGPP
QPPAASPTREGCPSPPGQTSKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVV
TALGRAWHPEHFLCSGCSTTLGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
ALGTHWHPEHFCCVSCGEPFGEEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISA
LSALWHPDCFVCRECLAPFSGGSFFEHEGRPLCENHFHAQRGSLCATCGLPVTGRCVSAL
GRRFHPDHFTCTFCLRPLTKGSFQERASKPYCQPCFLKLFG
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggaggacctggatgccctgctctctgacctggagaccaccacttcacacatgtcacgg
ttaggggctccaaaagagcgcccaccagagacactcacacctcccccaccctatggccac
cagccacagacagggtctggagaatcttcaggaaccactggggacaaggatcatctatac
agcacagtatgcaagcctcggtccccaaagcctgtggcccctgtggctcctccattctcc
tcttccagtggtgtgttgggcaatggcctctgtgagctagaccgtttgcttcaggaactt
aatgccacccagttcaacattacagatgaaatcatgtctcagttcccatctagtaaaatg
gctgaaggggaagagaaggaggaccaatctgaagacaagagctcacccactgtccctccc
agcccattccctgccccctcaaagccttcagccacctccgccactcaggaactggataga
ctgatggcctcgctctctgacttccgtgttcagaaccatcttccagcctcagggccacct
cagcctccagcagcgagccccacccgtgaaggatgcccatctccaccaggacagactagc
aaaggcagtctggacaccatgctgggcctgctgcagtctgacctcagccgtcgtggtgtc
cccacacaggccaaaggcctctgtggctcctgcaataaacctatagctgggcaagtggtt
acagccctgggcagagcctggcacccggagcacttcctttgcagcggttgttccacaacc
ctgggaggcagcagcttcttcgagaaggatggggctcccttttgccccgagtgctacttt
gagcgcttctccccacgatgtggcttctgtaaccaacccatccgacacaaaatggttacc
gccttgggcacccactggcacccagaacatttctgctgcgtcagctgcggagagcctttt
ggagaagagggtttccacgagcgggagggtcgtccgtactgccggcgggacttcctgcag
ctgttcgccccacgctgccagggctgccaaggccctattttggataactacatctcggca
ctcagcgcgctctggcacccagactgcttcgtgtgcagggaatgccttgcgcccttctcc
ggaggcagcttttttgagcacgagggtcgccctttgtgtgaaaaccatttccatgctcag
cgtggttcgctgtgtgccacgtgtggtctcccagtgaccggccgctgtgtgtccgctctg
ggccgacgcttccatccagaccacttcacctgcacattctgcctgcgcccactcaccaaa
ggctccttccaggagcgcgccagcaagccttactgccagccttgcttcctgaagctcttc
ggctga

DBGET integrated database retrieval system