KEGG   Mus musculus (house mouse): 21807
Entry
21807             CDS       T01002                                 
Symbol
Tsc22d1, Egr5, Gm19597, TSC-22, Tgfb1i4, Tsc, Tsc22
Name
(RefSeq) TSC22 domain family, member 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TSC22 YabA SOGA DUF6262 ZapB
Other DBs
NCBI-GeneID: 21807
NCBI-ProteinID: NP_997535
MGI: 109127
Ensembl: ENSMUSG00000022010
UniProt: P62500 Q3UXU0 E9QLZ1
Position
14:76652401..76745205
AA seq 1077 aa
MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGGGSASALNAAGTGVSGAAPSSEDFPP
PSLLQPPPPAASSTQGPQPPPPQSLNLLSQAQLQGQPLAPGGTQMKKKSGFQITSVTPAQ
ISASISSNNSIAEDTESYDDLDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNF
QEAETPGAVSPNQPHLPQPHLPHLPQQNVVINGNAHPHHLHHHHHPHHGHHLHHGHHHSS
HAAVAGPSIPGGPPSSPVSRKLSTTGSSDGGVPVAPPPAVPSSGLPASVMTNIRTPSTTG
SLGINSVTGTSATNNVNIAAVGSFSPSVTNSVHGNANINTSNIPNAASISGGPGVTSVVN
SSILSGMGNGTVSSSPVANSVLNAAAGITVGVVSSQQQQQQQQQPTVNTSRFRVVKLDST
SEPFKKGRWTCTEFYEKENAVPATEGVAVNKVVETVKQTPTEASSSERESTSGSSVSSSV
STLSHYTESVGSGEMMGAPAVVAPQQPPLPPAPPGLQGVALQQLEFSSPAPQSIAAVSMP
QSISQSQMSQVQLQPQELSFQQKQTLQPVPLQATMSAATGIQPSPVSVVGITAAVGQQPS
VSSLAQPQLPYSQTAPPVQTPLPGAPPQQLQYGQQQPMVPAQIAPGHGQPVTQNPTSEYV
QQQQQPIFQAALSSGQSSSTGTGAGISVIPVAQAQGIQLPGQPTAVQTQPAGAAGQPIGQ
AQTAVSTVPTGGQIASIGQQANIPTAVQQPSTQVTPSVIQQGAPPSSQVVLPAPTGIIHQ
GVQTRASSLPQQLVIAPQSTLVTVPPQPQGVETVAQGVVSQQLPTGSPLPSASTISVTNQ
VSSAAPSGMPSVPTNLVPPQNIAQPPATQNGSLVQSVSQSPLIATNINLPLAQQIPLSST
QFSTQSLAQAIGSQMEDARRPAEPSLGGLPQTMSGDSGGMSAVSDGSSSSLAAPASLFPL
KVLPLTTPLVDGEDESSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEK
NSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
NT seq 3234 nt   +upstreamnt  +downstreamnt
atgcaccagccgccggagtccaccgccgcggcggccgctgctgcagacattagtgctagg
aagatggcgcacccggcaatgttccctcgaaggggcagcggtggtggcagcgcctctgct
ctcaatgcagcaggtacgggcgtcagtggtgctgctccatcttctgaagattttcctcct
ccttcgctgctccagccgccgcctcctgctgcatcttccacgcagggaccccagcctccg
cctccacaaagcctgaacctcctctcgcaggctcagctgcagggacagcctcttgcgcca
ggcggaactcagatgaaaaagaaaagtggcttccagataactagcgttactccggctcag
atctctgccagcatcagctccaacaacagcatcgcggaggacaccgagagctacgacgat
ctggatgagtcgcacacggaagatctctcctcttccgagatcctcgacgtctccctttcc
agggccactgacttaggtgagcctgaacgaagctcctcagaggagactctgaataacttc
caggaagctgagacacctggggcagtctctcctaaccagccccaccttcctcagcctcat
ttgcctcaccttccacaacagaacgttgtgatcaatgggaatgcccatccccaccacctc
catcatcaccatcaccctcatcatgggcaccaccttcaccatgggcaccatcattcatca
catgctgctgtggccggtccatccattcccggagggccaccctcgagcccagtgtccagg
aaactctctacaactggaagttctgatggtggtgtgccagtcgcacctcctcctgcagta
ccatcgagtggcttaccagcatcagtgatgacgaacatccgtactccaagtactacagga
agcctaggtataaattcggttactggcacgagcgctacgaataatgttaacattgctgct
gtgggtagtttcagtcccagtgtgacgaacagcgtgcatggtaatgctaatataaataca
agcaatatccctaatgctgctagcataagtggtgggcctggagttaccagtgttgttaat
tcgagtatcttgagtggcatgggcaatggtaccgtttcttcctctcctgttgctaacagt
gtccttaatgcagctgcaggtatcactgtgggagtggtttccagtcagcagcagcagcag
cagcagcagcaaccaacagttaacacatcgaggttcagggttgtgaagttagactctact
tctgaaccctttaaaaaaggtcgatggacttgcacagaattctatgagaaggaaaacgct
gtgccagctacagaaggcgtggccgtcaataaagtggtggagacggtgaagcaaaccccc
acggaagcatcgtcctcggagagggagagcactagtgggagttctgtgagcagtagtgtg
agcacactgagtcactacacggagagtgtgggaagtggagagatgatgggagccccggct
gtggtggcgccgcagcagccgccgctaccaccagcgcctccaggtcttcaaggtgtggct
ctccaacagctagagttcagtagccctgctccacagagtattgcggcggttagtatgcca
cagagtatttctcagtcacagatgtcacaagtacagttacagcctcaagagttgagcttt
cagcagaagcagactcttcagcctgtccctctgcaagccaccatgagtgccgcaactggt
atccagccttcccctgtcagcgtggtcggcatcacggcggctgtaggtcagcagccttct
gtttccagcctggctcaaccgcagctgccatattctcagacagctcctcccgtgcaaact
cctcttccaggggcaccaccccagcagttacaatatgggcagcagcaaccaatggttcct
gcgcagatagccccaggccatggccagccagtgactcaaaatccaacttcagagtatgtg
cagcagcagcagcagccaatatttcaagcagcattgtcctctgggcagtccagttccacg
ggcacgggggcaggaatatcagtgattcctgtggctcaggcacaggggatccagctgcca
gggcagcccacagcagtacaaacacaacctgcaggggcggctgggcagcccattggccag
gctcaaacagcagtgtccactgtaccaactggcggtcagattgcaagtatcggtcaacag
gcaaacatacccactgcagtacagcagccctctacccaagttacaccttcagttattcag
caaggtgctcctccatcttcacaagtagtcctacctgctccaaccgggatcattcatcag
ggagttcaaacccgtgcttcaagccttccacaacaattggtcattgcaccccagagtacc
ttggtaactgtgcctccccagccacagggagtagaaaccgtggcccaaggggttgtttcc
cagcagttgcccacaggcagtcctctgccctctgctagcactatttctgttacaaatcag
gttagttcagccgctccttctggaatgccttctgtcccaacaaacttagttccaccacag
aatatagcacaacccccagccacccaaaatggcagtttggttcaaagtgttagtcaatct
cccttgatagccactaacataaatttgcctttggcacaacagataccactaagttctact
cagttctctacacaatcattagctcaggccattggaagccaaatggaagatgccaggcgc
ccagcggagccctccttaggcggcttacctcagactatgagtggtgacagtgggggaatg
tcagcagtttcagatgggagtagcagcagcctagcagcccctgcttctctcttcccgttg
aaggtgctaccgctgacaacacccctggtggatggcgaggacgagagctctggtgcaagt
gtggtagctatcgacaacaaaatagagcaagctatggatctggtgaaaagccatttgatg
tatgcggtgagggaggaagtggaagttctgaaggagcagatcaaagaactaatagagaaa
aactcccagctggagcaggagaacaatctgctgaagacgctggccagtccggagcagctc
gcccagtttcaggcccagctgcagactggctcccctccggccaccacgcagccacagggg
accacacagccccctgcacagccagcatcccagggctcaggatcaaccgcatag

DBGET integrated database retrieval system