KEGG   Mus musculus (mouse): 21812Help
Entry
21812             CDS       T01002                                 

Gene name
Tgfbr1, ALK5, AU017191, Alk-5, ESK2, TGFR-1, TbetaR-I, TbetaRI
Definition
(RefSeq) transforming growth factor, beta receptor I
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04144  Endocytosis
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04659  Th17 cell differentiation
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05142  Chagas disease (American trypanosomiasis)
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05220  Chronic myeloid leukemia
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Module
mmu_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21812 (Tgfbr1)
   04350 TGF-beta signaling pathway
    21812 (Tgfbr1)
   04390 Hippo signaling pathway
    21812 (Tgfbr1)
   04371 Apelin signaling pathway
    21812 (Tgfbr1)
   04068 FoxO signaling pathway
    21812 (Tgfbr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21812 (Tgfbr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    21812 (Tgfbr1)
  09143 Cell growth and death
   04218 Cellular senescence
    21812 (Tgfbr1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    21812 (Tgfbr1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    21812 (Tgfbr1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    21812 (Tgfbr1)
  09158 Development
   04380 Osteoclast differentiation
    21812 (Tgfbr1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    21812 (Tgfbr1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    21812 (Tgfbr1)
   05212 Pancreatic cancer
    21812 (Tgfbr1)
   05225 Hepatocellular carcinoma
    21812 (Tgfbr1)
   05226 Gastric cancer
    21812 (Tgfbr1)
   05220 Chronic myeloid leukemia
    21812 (Tgfbr1)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    21812 (Tgfbr1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    21812 (Tgfbr1)
   05161 Hepatitis B
    21812 (Tgfbr1)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    21812 (Tgfbr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    21812 (Tgfbr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     21812 (Tgfbr1)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   21812 (Tgfbr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 21812
NCBI-ProteinID: NP_033396
MGI: 98728
Ensembl: ENSMUSG00000007613
Vega: OTTMUSG00000006800
UniProt: Q64729 Q4FJL1
Position
4 B1; 4 26.02 cM
AA seq 503 aa AA seqDB search
MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCETDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAG
LGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggccgctgctccacgtcgtccgcagctcctcatcgtgttggtggcggcg
gcgacgctgctcccgggggcgaaggcattacagtgtttctgccacctctgtacaaaggat
aattttacctgtgagacagatggtctttgctttgtctcagtcactgagaccacagacaaa
gttatacacaatagtatgtgtatagctgaaattgacctaattcctcgagacaggccattt
gtatgtgcaccatcttcaaaaacaggggcagttactacaacatattgctgcaatcaggac
cactgcaataaaatagaactcccaactacaggacctttttcagaaaagcagtcagctggc
cttggtcctgtggagctggcagctgtcattgctggtccagtctgcttcgtctgcattgca
cttatgctgatggtctatatctgccataaccgcactgtcattcaccaccgtgtgccaaat
gaagaggatccatcactagatcgccctttcatttcagagggcaccaccttaaaagattta
atttatgatatgacaacatcagggtctggatcaggtttaccactgcttgttcaaagaaca
attgccaggaccattgtgttacaagaaagcattggcaaaggtcggtttggagaagtttgg
cgaggcaaatggcggggagaagaagttgctgtgaagatattctcttctagagaagagcgt
tcatggttccgagaggcagagatttatcagactgtaatgttacgccatgaaaatatcctg
ggatttatagcagcagacaacaaagacaatgggacatggacgcagctgtggttggtgtca
gattatcatgagcatggatcccttttcgattacttgaatagatacactgttactgtggaa
ggaatgatcaagcttgctctgtccacagcaagtggtcttgcccatcttcacatggagatt
gttggtacccaaggaaaaccagctattgcccatagagatttgaaatcaaagaatatcttg
gtgaagaaaaatggaacctgttgtattgcagacttgggacttgctgtgagacatgattct
gccacagatacaattgatattgctccaaaccacagagtaggcactaaaaggtacatggcc
cctgaagttctagatgattccataaatatgaaacattttgaatccttcaaacgcgctgac
atctatgcaatgggcttagtgttctgggaaattgctcgacgctgttctattggtggaatc
catgaagactatcagttgccttattatgatcttgtaccttctgatccatcggttgaagaa
atgagaaaagtagtttgcgaacagaagttaaggccaaatattccaaacagatggcagagc
tgtgaggccttgagagtgatggctaaaattatgagagaatgctggtatgccaatggagca
gcaaggctgacagctttgcgaattaaaaaaacattgtcacaactcagccaacaggaaggc
atcaaaatgtaa

DBGET integrated database retrieval system