KEGG   Mus musculus (mouse): 21814Help
Entry
21814             CDS       T01002                                 

Gene name
Tgfbr3, 1110036H20Rik, AU015626, AW215636, TBRIII
Definition
(RefSeq) transforming growth factor, beta receptor III
  KO
K05843  transforming growth factor, beta receptor III
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    21814 (Tgfbr3)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   21814 (Tgfbr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zona_pellucida
Motif
Other DBs
NCBI-GeneID: 21814
NCBI-ProteinID: NP_035708
MGI: 104637
Ensembl: ENSMUSG00000029287
Vega: OTTMUSG00000028168
UniProt: O88393 A0A0R4J097
Structure
PDB: 

Position
5; 5 E5
AA seq 850 aa AA seqDB search
MAVTSHHMVPVFVLMSACLATAGPEPSTRCELSPISASHPVQALMESFTVLSGCASRGTT
GLPREVHILNLRSTDQGLGQPQREVTLHLNPIASVHTHHKPVVFLLNSPQPLVWHVKTER
LAAGVPRLFLVSEGSVVQFSSGNFSLTAETEERSFPQENEHLLHWAQKEYGAVTSFTELK
IARNIYIKVGEDQVFPPTCNIGKNFLSLNYLAEYLQPKAAEGCVLASQPHEKEVHIIELI
SPNSNPYSTFQVDIIIDIRPAREDPEVVKNLVLILKCKKSVNWVIKSFDVKGNLKVIAPD
SIGFGKESERSMTVTKLVRNDIPSTQENLMKWALDNGYSPVTSYTIAPVANRFHLRLENN
EEMRDEEVHTIPPELRILLGPDHLPALDSPSFQGEIPNGGFPFPFPDIPRRGWKEGEDRI
PRPKEPIIPRVQLLPDHREPEEVQGGVNIALSVKCDNEKMVVAVDKDSFQTNGYSGMELT
LLDPSCKAKMNGTHFVLESPLNGCGTRHRRSAPDGVVYYNSIVVQAPSPGDSSGWPDGYE
DLESGDNGFPGDTDEGETAPLSRAGVVVFNCSLRQLRSPSGFQDQLDGNATFNMELYNTD
LFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFISPYSNPDRMSDYTIIENICP
KDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRKKGSQKLPK
CVTPDDACTSLDATMIWTMMQNKKTFTKPLAVVLQVDYKENVPNMKESSPVPPPPQIFHG
LDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETARRQQVPTSPPASENSSAAHSIGSTQ
STPCSSSSTA
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgacatcccaccacatggtccctgtgtttgtcctgatgagcgcctgcctggcc
accgcaggtccagagcccagcacccggtgtgaactgtcaccgatcagtgcctctcatcca
gtccaggccctgatggagagcttcaccgttctgtctggctgtgccagcagaggcaccact
gggctgccaagggaggttcacatcctaaacctccgcagtacagaccaaggactaggccag
ccgcagagagaggttaccctgcatctgaaccccattgcctccgtgcacactcaccacaag
cctgttgtgttcctgctcaactccccacagcccctggtgtggcatgtgaagacagagaga
ctggctgctggtgtccccagactcttcctggtttcggagggttctgtggtccagttttca
tcaggaaacttctccttgacagcagaaacagaggaaaggagtttccctcaagaaaatgag
catctgctacactgggcccaaaaggaatatggagcagtgacttcattcaccgaacttaag
atagcaagaaatatctatattaaagtgggagaagatcaagtgttccctcccacgtgtaac
atagggaaaaattttctctcgctcaattaccttgcggagtaccttcaacccaaagccgcc
gaaggttgtgtcctggccagtcagccccacgagaaggaagtgcatatcattgagttaatc
tcccccaactccaatccttacagcaccttccaggtggatataataattgacatacgacct
gctcgagaggatcctgaggtggtcaaaaacctcgtcctgatcttgaagtgcaaaaaatct
gtcaactgggtgatcaagtcttttgacgtcaagggaaacttgaaagttattgctcctgac
agtattggctttggaaaagagagtgaacgatccatgacagtgaccaaattggtaagaaat
gacatcccttccacccaagagaatctgatgaagtgggcattggacaatggctacagccca
gtgacgtcatacaccatagctcctgtggccaatagatttcatcttcggcttgagaacaac
gaggagatgagagatgaggaagtccacaccattcctcctgagcttcggatcctgctgggc
cctgaccacctgcctgccctggacagcccatccttccaaggggaaatcccaaatggaggt
ttccccttcccattcccggatatccccaggagaggctggaaggagggagaagataggatc
ccccggccaaaggaacccatcattcccagagttcaattgcttccagaccacagagagcca
gaagaagtgcaagggggcgtgaatatcgccctgtcagtcaaatgtgacaatgaaaagatg
gtggtagctgtagacaaagattctttccagaccaatggctactcggggatggagctcacc
ctgttggatccttcctgcaaagccaagatgaatggtacccactttgtactggagtctccg
ctgaatggctgtggtactagacataggaggtcagccccagatggtgtggtttactataac
tctattgtggtgcaggctccatcccctggggatagcagtggctggccagacggctacgaa
gatttggagtcgggtgataatggatttcctggagacacagatgaaggagaaactgccccc
ctgagccgtgctggagtggtagtgtttaactgcagcttgcggcagctgaggagtcccagt
ggcttccaggaccagctcgatggaaatgctaccttcaacatggagctgtataacacagac
ctctttctggtgccctccccaggggtcttctctgtggcagagaatgagcatgtatatgtt
gaggtgtctgtcactaaggctgaccaagatctgggatttgccatccaaacctgctttatc
tctccatactcaaacccagacagaatgtctgattacaccatcatcgagaacatctgtccg
aaggatgactctgtgaagttctacagctccaagagagtgcacttccccatcccacatgct
gaagtggacaagaagcggttcagctttgtgttcaagtccgtgttcaacacctccctgctc
ttcctgcactgcgagctgacgctgtgctctaggaagaagggctcccagaagctgccaaag
tgtgtgactcctgacgacgcctgcacctctctagatgccaccatgatctggaccatgatg
cagaataagaagacattcaccaagcccctggccgtggtcctccaagtagattataaagaa
aatgttccaaacatgaaggagtccagtccggttcctcctcctccacagattttccacggc
ctggacacgctcaccgtgatgggcattgcgtttgcagcatttgtgatcggagcactcctg
acgggggccttgtggtatatctactcccacacaggggagacggcacgaaggcagcaagtc
cctacctcgccaccagcctcggagaacagcagcgcagcccacagcatagggagcactcag
agcactccctgctctagcagcagcacggcctag

DBGET integrated database retrieval system