KEGG   Mus musculus (mouse): 21817Help
Entry
21817             CDS       T01002                                 

Gene name
Tgm2, G[a]h, TG2, TGase2, tTG, tTGas
Definition
(RefSeq) transglutaminase 2, C polypeptide
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    21817 (Tgm2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     21817 (Tgm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 21817
NCBI-ProteinID: NP_033399
MGI: 98731
Ensembl: ENSMUSG00000037820
Vega: OTTMUSG00000015888
UniProt: P21981
Position
2 H1; 2 78.72 cM
AA seq 686 aa AA seqDB search
MAEELLLERCDLEIQANGRDHHTADLCQEKLVLRRGQRFRLTLYFEGRGYEASVDSLTFG
AVTGPDPSEEAGTKARFSLSDNVEEGSWSASVLDQQDNVLSLQLCTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLYNAWCPADDVYLDSEEERREYVLTQQGFIYQGSVKFIKSVPW
NFGQFEDGILDTCLMLLDMNPKFLKNRSRDCSRRSSPIYVGRVVSAMVNCNDDQGVLLGR
WDNNYGDGISPMAWIGSVDILRRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGELESNKSEMIWNFHCWVESWMTRPDLQPGYEGWQAIDPT
PQEKSEGTYCCGPVSVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQEDGSVLKSINRSL
VVGQKISTKSVGRDDREDITHTYKYPEGSPEEREVFTKANHLNKLAEKEETGVAMRIRVG
DSMSMGNDFDVFAHIGNDTSETRECRLLLCARTVSYNGVLGPECGTEDINLTLDPYSENS
IPLRILYEKYSGCLTESNLIKVRGLLIEPAANSYLLAERDLYLENPEIKIRVLGEPKQNR
KLVAEVSLKNPLSDPLYDCIFTVEGAGLTKEQKSVEVSDPVPAGDLVKARVDLFPTDIGL
HKLVVNFQCDKLKSVKGYRNVIIGPA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggagctgctcctggagaggtgtgatttggagattcaggccaatggccgtgac
caccacacggccgacctatgccaagagaaactggtgctgcgtcgtggtcagcgcttccgg
ctgactctgtacttcgagggccgtggctacgaggccagcgtggacagcctcacgttcggt
gctgtgaccggcccagatcccagtgaagaggcagggaccaaggcccgcttctcactgtct
gacaatgtggaggagggatcttggtcagcctcagtgctggaccaacaggacaatgtcctc
tcgctacagctctgcaccccagccaatgctcctattggcctgtaccgtctcagcctagag
gcttctactggctaccagggctccagctttgtgctgggccacttcatcctgctctacaat
gcctggtgcccagccgatgatgtgtacctagactcagaggaggagcgacgggaatatgtc
cttacgcaacagggcttcatctaccaaggctctgtcaagttcatcaagagtgtgccttgg
aactttgggcagttcgaggatggaatcctggatacctgcctgatgctcttggatatgaac
cccaagttcctgaagaaccgtagtcgggactgctcacgccgcagcagtcccatctatgtg
ggccgcgtggtgagcgccatggtcaactgcaatgatgaccagggtgtgcttctgggccgc
tgggacaacaactatggggatggtatcagtcccatggcctggattggcagtgtggacatt
ctgcggcgctggaaggaacacggctgtcagcaagtgaagtacgggcagtgctgggtgttt
gcagcggtggcctgcacagtgctgcggtgcctcggcatccctaccagagtggtgaccaac
tacaactccgcccacgaccagaacagcaacctgctcatcgagtacttccgaaatgagttc
ggggagctggagagcaacaagagcgagatgatctggaacttccactgctgggtggagtcc
tggatgaccaggccagacctacagccgggctatgaggggtggcaggccattgaccccaca
ccacaggagaagagcgaagggacatactgttgtggcccagtctcagtgcgagccatcaag
gagggagacctgagtaccaagtatgatgcacccttcgtgtttgccgaggtcaacgctgat
gtggtggactggatccggcaggaagatgggtctgtgctcaaatccatcaaccgttccttg
gtcgtggggcagaagatcagcactaagagtgtgggccgtgatgaccgggaggacatcacc
catacctacaagtacccagaggggtcacccgaggagagggaagtcttcaccaaggccaac
cacctgaacaaactggcagagaaagaggagacaggggtggccatgcgcatccgagtgggg
gacagtatgagcatgggcaacgacttcgacgtgtttgcccacatcggcaacgacacctcg
gagactcgagagtgtcgtctcctgctctgtgcccgcactgtcagctacaacggggtgctg
gggcccgagtgtggcactgaggacatcaacctgaccctggatccctactctgagaacagc
atcccacttcgaatcctctacgagaagtacagcgggtgcctgacagagtcaaacctcatc
aaggtgcggggccttctcatcgaaccagctgccaacagctacctgctggctgagagagat
ctctacctggagaatcccgaaatcaagatccgggtcctgggagaacccaagcaaaaccgc
aaactggtggctgaggtgtccctgaagaacccactttccgatcccctgtatgactgcatc
ttcactgtggagggggctggcctgaccaaggagcagaagtctgtggaagtctcagacccg
gtgccagcgggcgatttggtcaaggcacgggtcgacctgttcccgactgatattggcctc
cacaagctggtggtgaacttccagtgtgacaagctgaagtcggtgaagggttaccggaat
gttatcatcggcccggcctaa

DBGET integrated database retrieval system