KEGG   Mus musculus (mouse): 21818Help
Entry
21818             CDS       T01002                                 

Gene name
Tgm3, AI893889, TG_E, TG(E), TGE, TGase_E, TGase-3, we
Definition
(RefSeq) transglutaminase 3, E polypeptide
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    21818 (Tgm3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     21818 (Tgm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 21818
NCBI-ProteinID: NP_033400
MGI: 98732
Ensembl: ENSMUSG00000027401
Vega: OTTMUSG00000015499
UniProt: Q08189
Position
2; 2 F1
AA seq 693 aa AA seqDB search
MSALQIQNVNWQVPMNRRAHHTDKFSSQDSIVRRGQPWEIILVCNRSLESGEDLNFIVST
GPQPSESARTKAVFSISGRSTGGWNAALKANSGNNLAIAIASPVSAPIGLYTLSVEISSR
GRASSLKLGTFIMLFNPWLQADDVFMSNHAERQEYVEEDSGIIYVGSTNRIGMVGWNFGQ
FEEDILNISLSILDRSLNFRRDPVTDVARRNDPKYVCRVLSAMINGNDDNGVISGNWSGN
YTGGVDPRTWNGSVEILKNWKKSGFRPVQFGQCWVFAGTLNTVLRCLGVPSRVITNFNSA
HDTDRNLSVDVYYDAMGNPLEKGSDSVWNFHVWNEGWFVRTDLGPTYNGWQVLDATPQER
SQGVFQCGPASVNAIKAGDVDRNFDMIFIFAEVNADRITWIYNNRNNTQKQNSVDTHSIG
KYISTKAVGSNSRMDVTDKYKYPEGSSEERQVHQKALDKLKPNASFGATSSRNPEGEDKE
PSISGKFKVTGILAVGKEVSLSLMLKNMTNDRKTVTMNMTAWTIVYNGTLVHEVWKDSAT
ISLDPEEEIQYPVKIAYSQYERYLKADNMIRITAVCKVPDEAEVVVERDVILDNPALTLE
VLEQAHVRKPVNVQMLFSNPLDQPVNNCVLLVEGSGLLRGSLKIDVPSLRPKEKSRIRFE
IFPTRSGTKQLLADFSCNKFPAIKAMLPIDVSE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttacagatccaaaacgtcaactggcaggtgcctatgaatcgaagggcgcat
cacacagacaagttctccagccaggattccattgtgcggagaggacagccctgggagata
atattagtctgcaaccgaagtcttgagtctggagaagatctgaatttcattgtttccaca
ggtccccaaccctctgagtcagccaggacaaaggctgtattttccatctctgggagaagc
acgggtggctggaatgcagcgctcaaagccaacagtggcaataatctggccattgctatt
gccagtcctgtcagtgctcccatcggattgtacacactgagtgttgagatctcctccagg
ggcagggcctcctctctgaaacttggcacgtttataatgctcttcaacccgtggttgcaa
gcggatgatgtctttatgagtaaccacgccgaaagacaagagtatgttgaagaagattct
ggcatcatctatgtgggcagcacaaatcgaattggcatggttggctggaactttggacag
tttgaagaagacattctgaacatcagcctctccattttggataggagtctgaatttccgt
cgtgaccctgtgactgatgtggctcgcagaaatgaccccaaatatgtttgccgggtgctg
agtgccatgattaatggcaatgatgacaacggtgttatttctgggaactggagtggtaat
tacaccggtggtgtggacccaaggacctggaatggtagtgtggagatcctcaagaactgg
aaaaaatctggcttcaggccagtccaatttggccagtgctgggtctttgctggaaccctc
aacacagtgctgcggtgcttgggggttccctctcgggtgatcaccaacttcaactcggct
cacgacacagatcgaaacctcagtgtggatgtgtactacgatgccatgggaaatcccctg
gagaaaggcagtgatagcgtgtggaattttcacgtctggaatgaaggctggttcgtgcgg
actgacctaggccccacatacaatggatggcaggtcctggatgccaccccccaggagaga
agtcaaggtgtgttccagtgcggtccagcttccgttaatgcaatcaaagccggtgatgtg
gaccggaattttgacatgatcttcatcttcgcggaggttaatgcagatcgcatcacttgg
atctataataatagaaataacacccagaagcagaattctgtggacactcactccattggc
aaatacatcagcaccaaggcagtaggcagcaactctcgcatggatgtcacagacaagtac
aagtatccagaaggttccagtgaggaaagacaagtgcaccaaaaggctttggacaaactc
aaacctaacgcatctttcggcgcaacatcttcgaggaatccagaaggggaagacaaggag
cccagcatttctgggaagttcaaggtcacggggatactggcagtaggcaaagaagtcagt
ctgtccctgatgctcaaaaacatgactaatgacaggaagacagtgacgatgaacatgaca
gcctggaccatcgtctacaatggtacccttgtccacgaagtgtggaaggactcagccaca
atatccttggatcctgaagaagaaatacagtatcctgtgaagatcgcatactctcagtat
gagagatacctgaaggcagacaacatgatccggatcacagctgtttgcaaggtgcccgat
gaggctgaggtggtggtggaacgggatgtcatcctggataatcctgctttgaccctggag
gtgctggaacaggctcatgtgcggaagcccgtgaacgtgcagatgcttttctccaacccc
ctggaccagccggtgaataactgcgtgctgctggtggagggcagcggcctgctgcgtggc
agcctcaagattgatgtgccatccctgcgccccaaggagaagtcccgcatccgatttgag
attttccccactcggagtggcaccaagcaactgctcgctgacttttcctgcaataaattc
cctgcaatcaaggccatgctgcccattgatgtctctgagtga

DBGET integrated database retrieval system