KEGG   Mus musculus (mouse): 21819
Entry
21819             CDS       T01002                                 

Gene name
Tg, Tgn, cog
Definition
(RefSeq) thyroglobulin
  KO
K10809  thyroglobulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04918  Thyroid hormone synthesis
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    21819 (Tg)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    21819 (Tg)
SSDB
Motif
Pfam: COesterase Thyroglobulin_1 Ephrin_rec_like Abhydrolase_3 KdpC
Other DBs
NCBI-GeneID: 21819
NCBI-ProteinID: NP_033401
MGI: 98733
Ensembl: ENSMUSG00000053469
Vega: OTTMUSG00000035631
UniProt: O08710
Position
15 D2; 15 29.3 cM
AA seq 2766 aa
MTALVLWVSTLLSSVCLVAANIFEYQVDAQPLRPCELQREKAFLKQAEYVPQCSEDGSFQ
TVQCQNDGQSCWCVDSDGREVPGSRQLGRPTVCLSFCQLHKQRILLGSYINSTDALYLPQ
CQDSGNYAPVQCDLQRVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRNRRLLHGVGDRS
PPQCTADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSSFRGRFPEVSGYCYCAD
SQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
KCEVEQFAATRFGHSYIPRCHRDGHYQTVQCQTEGMCWCVDAQGREVPGTRQQGQPPSCA
ADQSCALERQQALSRFYFETPDYFSPQDLLSSEDRLAPVSGVRSDTSCPPRIKELFVDSG
LLRSIAVEHYQRLSESRSLLREAIRAVFPSRELAGLALQFTTNPKRLQQNLFGGTFLANA
AQFNLSGALGTRSTFNFSQFFQQFGLPGFLNRDRVTTLAKLLPVRLDSSSTPETLRVSEK
TVAMNKRVVGNFGFKVNLQENQDALKFLVSLLELPEFLVFLQRAVSVPEDIARDLGDVME
MVFSAQACKQMPGKFFVPSCTAGGSYEDIQCYAGECWCVDSRGKELDGSRVRGGRPRCPT
KCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFLPVQCFNSECYCVDTEGQVIPGTQSTV
GEAKQCPSVCQLQAEQAFLGVVGVLLSNSSMVPSISNVYIPQCSASGQWRHVQCDGPHEQ
VFEWYERWKTQNGDGQELTPAALLMKIVSYREVASRNFSLFLQSLYDAGQQRIFPVLAQY
PSLQDVPQVVLEGATTPPGENIFLDPYIFWQILNGQLSQYPGPYSDFNMPLEHFNLRSCW
CVDEAGQKLDGTQTKPGEIPACPGPCEEVKLRVLKFIKETEEIVSASNASSFPLGESFLV
AKGIQLTSEELDLPPQFPSRDAFSEKFLRGGEYAIRLAAQSTLTFYQSLRASLGKSDGAA
SLLWSGPYMPQCNMIGGWEPVQCHAGTGQCWCVDGRGEFIPGSLMSRSSQMPQCPTNCEL
SRASGLISAWKQAGPQRNPGPGDLFIPVCLQTGEYVRKQTSGTGTWCVDPASGEGMPVNT
NGSAQCPGLCDVLKSRALSRKVGLGYSPVCEALDGAFSPVQCDLAQGSCWCVLGSGEEVP
GTRVVGTQPACESPQCPLPFSGSDVADGVIFCETASSSGVTTVQQCQLLCRQGLRSAFSP
GPLICSLESQHWVTLPPPRACQRPQLWQTMQTQAHFQLLLPPGKMCSVDYSGLLQAFQVF
ILDELIARGFCQIQVKTFGTLVSSTVCDNSSIQVGCLTAERLGVNVTWKLQLEDISVGSL
PDLYSIERAVTGQDLLGRFADLIQSGRFQLHLDSKTFSADTTLYFLNGDSFVTSPRTQLG
CMEGFYRVPTTRQDALGCVKCPEGSFSQDGRCTPCPAGTYQEQAGSSACIPCPRGRTTIT
TGAFSKTHCVTDCQKNEAGLQCDQNGQYQASQKNRDSGEVFCVDSEGRKLQWLQTEAGLS
ESQCLMIRKFDKAPESKVIFDANSPVIVKSSVPSADSPLVQCLTDCANDEACSFLTVSTM
ESEVSCDFYSWTRDNFACVTSDQEQDAMGSLKATSFGSLRCQVKVRNSGKDSLAVYVKKG
YESTAAGQKSFEPTGFQNVLSGLYSPVVFSASGANLTDTHTYCLLACDNDSCCDGFIITQ
VKGGPTICGLLSSPDILLCHINDWRDTSATQANATCAGVTYDQGSRQMTLSLGGQEFLQG
LALLEGTQDSFTSFQQVYLWKDSDMGSRPESMGCERGMVPRSDFPGDMATELFSPVDITQ
VIVNTSHSLPSQQYWLFTHLFSAEQANLWCLSRCAQEPIFCQLADITKSSSLYFTCFLYP
EAQVCDNVMESNAKNCSQILPHQPTALFRRKVVLNDRVKNFYTRLPFQKLTGISIRDKVP
MSGKLISNGFFECERLCDRDPCCTGFGFLNVSQLQGGEVTCLTLNSMGIQTCNEESGATW
RILDCGSEDTEVHTYPFGWYQKPAVWSDTPSFCPSAALQSLTEEKVTSDSWQTLALSSVI
VDPSIKHFDVAHISTAATSNFSMAQDFCLQQCSRHQDCLVTTLQIQPGVVRCVFYPDIQN
CIHSLRSHTCWLLLHEEATYIYRKSGIPLVQSDVTSTPSVRIDSFGQLQGGSQVIKVGTA
WKQVYRFLGVPYAAPPLADNRFRAPEVLNWTGSWDATKPRASCWQPGTRTPTPPQINEDC
LYLNVFVPENLVSNASVLVFFHNTMEMEGSGGQLTIDGSILAAVGNFIVVTANYRLGVFG
FLSSGSDEVAGNWGLLDQVAALTWVQSHIGAFGGDPQRVTLAADRSGADVASIHLLISRP
TRLQLFRKALLMGGSALSPAAIISPERAQQQAAALAKEVGCPTSSIQEVVSCLRQKPANI
LNDAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVDLLIGGSQDDGLINRAK
AVKQFEESQGRTNSKTAFYQALQNSLGGEDSDARILAAAVWYYSLEHSTDDYASFSRALE
NATRDYFIICPMVNMASLWARRTRGNVFMYHVPESYGHGSLELLADVQYAFGLPFYSAYQ
GQFSTEEQSLSLKVMQYFSNFIRSGNPNYPHEFSRKAAEFATPWPDFIPGAGGESYKELS
AQLPNRQGLKQADCSFWSKYIQTLKDADGAKDAQLTKSEEEDLEVGPGLEEDLSGSLEPV
PKSYSK
NT seq 8301 nt   +upstreamnt  +downstreamnt
atgacggccctggtcttgtgggtctctactttgttgagctcagtctgcctggtagcagcc
aacatctttgagtaccaggtagatgcacagccactccgcccctgtgagctacaaagagag
aaggcctttctgaagcaggctgaatatgttccccagtgctctgaagatggaagtttccag
acagtccaatgccaaaatgatggtcaatcttgctggtgtgtggattctgatggcagagaa
gtacctggcagcaggcagctggggaggccaacagtttgtctgtccttctgccagctacac
aagcaacggatcctgctgggcagctacattaacagcaccgatgctctctaccttcctcag
tgccaggattcagggaactatgcaccagtgcagtgtgacctgcagagagtgcaatgctgg
tgtgtagacacagaggggatggaagtgtatggcacccgccagcagggcaggccaactcgg
tgtccaaggagctgtgagataagaaaccggcgtctcctccatggagtaggagacaggtca
ccaccccagtgcactgcagatggggagtttatgcctgtccagtgcaagtttgtcaatacc
acagacatgatgatttttgatctgatccacaactacaacaggtttccagatgcatttgtg
accttcagttccttccggggcaggttccctgaagtgtctgggtactgttactgtgctgac
agccaggggcgggagctggctgagacaggactggaattgttactggatgaaatttatgac
accatttttgctggcttggaccaggcctcgaccttcactcaaagcaccatgtaccggata
ttgcagagacgattcctggccatccaattagtcatctctggcagatttcggtgccccact
aagtgtgaagtagaacagtttgctgccaccagatttggtcattcttacatcccgagatgc
cacagagatggtcactaccaaacagtacagtgccagacagaagggatgtgctggtgtgtg
gatgcccaggggagagaggtccctggcactcggcagcaagggcagcctccatcttgcgct
gcagatcagtcatgtgccttggaaaggcagcaggccttgtctaggttctactttgaaacc
ccagactacttcagtccgcaggaccttttgtcttcagaggacaggctcgctcctgtgagt
ggtgtcagatcggacacatcctgcccacccagaatcaaggaactctttgttgactctgga
ctcctgcgttcgatagctgtggagcactaccaacggctttctgaatccagaagtctacta
agagaagccatcagagcagttttcccctcccgggagctggcagggcttgcccttcagttc
accaccaaccccaagcgactccagcagaacctgtttggagggacatttttggcgaatgct
gcccagtttaacttgtcaggagcccttggtacaagaagcacatttaacttcagtcagttt
ttccagcagtttggtctcccaggcttcctgaatagagacagagttactactcttgccaaa
ctactccctgtgagattggactccagttctaccccagaaactctccgtgtgtctgagaag
acagttgctatgaataaacgagttgtgggtaactttggcttcaaagtcaacctacaagag
aaccaagatgccttaaaatttctcgtttctctcctggaacttccagaattccttgtcttc
ttgcagcgtgctgtttctgtgccggaagatatagcgagagatttaggagatgtgatggaa
atggtgttcagtgctcaagcctgtaaacagatgcctgggaagttctttgtcccatcatgc
actgctggaggaagctatgaggatatacagtgctatgctggagaatgctggtgtgtagat
tcccgaggcaaagaacttgatggctcgagagtcagaggtggacgcccaagatgtcccacc
aagtgtgaaaagcagagagctcagatgcaaagcctcgcaagcgctcagcccgccggctcc
agcttttttgttcctacttgtactagagagggatattttctgcctgtccagtgcttcaac
tcagaatgttactgtgtggatactgaaggccaggttattcctgggactcaaagtacagtt
ggagaagccaagcagtgtcccagtgtctgccaattacaggctgaacaagctttccttggg
gtagtaggggttctgctctcgaactccagcatggtgccctccatctccaatgtctacatc
cctcagtgcagtgccagtggccagtggaggcatgtgcagtgtgatgggccccatgagcag
gtctttgagtggtatgaacgatggaagactcagaacggtgatggccaggaactgacccca
gccgcactgctaatgaagatcgtgagctacagagaagtagcttccagaaacttcagcctc
tttcttcaaagtctctatgatgctggccagcaaagaatctttccagtgctagcacagtac
ccatctcttcaagatgttccacaggtagtgttggagggagccacaactccgcctggggag
aacattttcctggatccgtacatcttttggcagatcctaaatggtcagctcagccaatac
ccaggtccctactcagactttaacatgcctttggaacacttcaacctcaggagctgttgg
tgtgtggatgaggctggccagaaactggatggtactcagactaagccaggcgagatccca
gcatgtcctggcccatgtgaggaagtgaaacttcgtgtcctgaaatttattaaggaaaca
gaagagattgtctcagcctccaatgcttcttcatttccactgggagagagtttcttagtg
gccaagggaatccagctgaccagtgaggagcttgaccttcctccccaattcccatcccgg
gatgctttctctgagaagtttctacgtgggggtgaatatgccattcgcttggctgctcag
tccaccttgactttctatcagagtctccgtgcttccctgggaaagtccgatggagcagcc
agtcttctgtggtcagggccctacatgccacaatgcaatatgattggaggctgggaacct
gtgcagtgccatgctgggacaggacagtgttggtgtgtggatggaaggggagagttcatt
ccaggctcgctgatgtcacgctcctcacagatgccccagtgtcccacaaactgtgagcta
tccagagcaagtgggttgatttctgcatggaaacaggctggaccccaaagaaatccaggc
ccgggagatctgttcataccagtctgcctccagacgggagagtatgtcaggaagcagaca
tcagggacaggaacatggtgtgtggatccagcctcaggagaagggatgccagtgaacaca
aatggcagtgctcagtgtcctggcctctgtgatgtcctcaagagcagagccctgtccagg
aaagtgggtcttggctactctccagtctgtgaggcactggatggagccttctccccagtg
caatgtgacttggcccagggcagttgttggtgtgtcctgggaagtggagaggaagtgcca
gggacccgtgtggtaggcacccagcctgcctgtgaaagcccacagtgtccactgccattc
tctgggtcagatgtggctgatggagtgatcttctgcgagacagcctctagctcaggagtg
acgactgttcagcagtgccagctgctgtgccgccagggcctccggagtgcgttttcacca
gggccactgatttgtagcctggagagtcagcactgggtgacactgccaccaccccgagcc
tgtcaaaggcctcagctgtggcagaccatgcaaactcaagcacacttccagctcctgctc
ccaccaggaaagatgtgcagtgttgactactccggcttgctgcaggccttccaggtcttc
atactggatgagctgatagcccgtggcttctgccagatccaggtaaagacatttgggacc
ctggtttccagcactgtctgtgacaactcctcaatacaggtggggtgtctgactgcagag
cgtttaggagtaaatgtcacgtggaagttacagcttgaggacatctcagtgggctcactt
ccagatttgtacagcattgaaagggcggtaacgggccaggatctccttgggcgctttgca
gatctgatccaaagtggcaggttccagcttcatctggactccaagacattctcagcggac
accaccttgtattttctcaatggtgacagctttgtcacctctcccaggactcagcttgga
tgtatggaagggttctacagagtcccaaccaccagacaggatgctctgggctgtgtgaaa
tgccctgaaggaagcttctctcaggatgggcgatgcactccctgtcctgctggcacctac
caagaacaggcaggcagctcagcctgcatcccatgcccaaggggcagaacaaccatcacc
actggagctttcagcaagacccattgtgtcactgactgtcagaagaatgaggctggccta
cagtgtgaccagaatggtcagtaccaagccagccagaagaacagggacagtggggaagtt
ttctgcgtggacagcgaggggcggaaactacagtggttacagacagaggctggactctca
gaatctcagtgtctgatgatacggaaatttgacaaagctccagaatcgaaggttatcttt
gatgctaattctcctgtgatagtcaagtccagtgtccccagtgctgactccccgctggtg
cagtgcttgacagattgtgcaaatgatgaggcctgcagcttccttacagtgtccacaatg
gagtcagaggtttcatgtgacttttattcttggacaagggacaactttgcctgcgtgact
tctgaccaggaacaagatgctatgggcagcctgaaggcaaccagtttcgggagcctcagg
tgccaggtgaaagtgagaaatagtggcaaggattctctggctgtgtatgtgaagaaaggc
tatgaatctactgcagctggtcagaagagcttcgaaccaacgggttttcaaaatgtgctc
tctgggttatatagccctgtggtgttctcagcctcaggagccaatctgacagatacacac
acctactgtctgcttgcctgtgacaatgattcctgctgtgatggcttcatcatcacacag
gttaaaggagggcccaccatctgtggacttctcagttctcctgacattctgctttgccac
atcaatgactggagggatacctctgctactcaggccaatgctacatgtgctggggtgaca
tatgaccaggggagccgccagatgaccttgagtctgggaggccaagagttcctgcagggt
ctggcactcttggaaggaactcaagacagctttaccagcttccagcaggtctacctctgg
aaagattctgacatggggtctcggccggagtctatgggatgtgaaaggggaatggtgcca
aggtcagactttccaggagatatggcaacagaacttttttcccctgtggacattacccag
gtcattgtcaacacaagccattcattgcccagccagcagtactggctcttcacacacctg
ttttcagcagagcaggcaaacctgtggtgcctttctcggtgtgcccaggagcccattttc
tgtcaacttgcagacataacaaaaagttcatctttgtatttcacctgcttcctataccca
gaagctcaggtctgtgacaatgtcatggaatctaatgccaagaactgcagtcagattctg
ccccaccaaccaacggccctcttccggaggaaagttgtgctgaatgatagagtgaagaac
ttttatactcgcctgccattccaaaagctcacagggatttccatcagagacaaagtcccc
atgtctggaaaactcatttccaatgggttctttgagtgtgagcggctctgtgacagggac
ccttgctgcactggctttggttttctaaatgtctcccagctgcaaggaggagaggtgacc
tgtctgactctgaacagcatggggattcaaacatgcaatgaggagagtggagcaacctgg
cgcattttggactgtggctctgaggacacagaagtccacacctatccctttgggtggtac
cagaagcctgctgtatggagtgacactcctagcttctgcccttctgctgccctgcaatcc
ctcactgaggagaaggttacttcggactcttggcagaccctggccctgtcttcagtgatt
gtagatccatccatcaagcactttgatgttgcccacatcagcactgcagccaccagtaac
ttctccatggcccaagacttctgcttacagcaatgttcccgtcaccaggactgccttgtc
actaccctgcagatccagcctggggttgtgagatgtgtgttctaccctgatatacagaac
tgcatacacagtctacggagccacacgtgctggcttctgctccatgaagaggctacctac
atctaccggaagtctggaatccctttggtccaatctgatgtaacatccacaccttctgta
cgcattgattcctttggccagcttcagggtgggtcccaggtcatcaaggtgggcactgcc
tggaagcaagtataccggttccttggagttccatatgctgccccacccttggcagacaac
cgcttccgggcaccagaggtcttgaattggacaggttcatgggatgctaccaagccaagg
gccagctgctggcagccaggtacccgtacccccacacctccacaaatcaatgaagactgc
ttatatctcaatgtgtttgtccctgagaacctggtctccaatgcatcagttctggtgttt
ttccacaataccatggagatggaaggcagtggtggtcagctgaccattgatggctccatc
ctggctgcagttggcaacttcatcgtagtcactgctaactacagactgggggtcttcggc
ttcctgagttcaggctctgatgaagtagctggcaactgggggctgctggaccaagtggca
gctctaacgtgggtgcagtcccacattggagcatttggtggggaccctcagcgtgtgaca
ctggcagcagaccgtagtggggctgatgtggccagcatacaccttctcatcagcaggcct
acaaggctccagctcttcaggaaggcactgcttatgggaggctctgcactgtccccggct
gcaattatcagcccagagagggcccaacagcaagctgcagccttggcaaaggaggttgga
tgccctacttcatccatccaggaagtggtatcatgtctccgccagaagcctgccaacatt
ctcaatgatgctcagaccaagctcctggctgtgagtggccctttccactactggggccct
gtggtcgatggccagtacctccgtgaacttccatccagacggttgaagaggcctctgcca
gtgaaggtggatctactcataggagggtcccaggatgatgggcttatcaatagggcaaag
gctgtgaagcaatttgaagagagccaaggccgaaccaacagcaaaacagccttttaccag
gcactgcagaattcactcggtggtgaggactcagatgcccgcatccttgctgctgctgta
tggtattactccttggagcactccacagacgactatgcctccttctctcgggcactggag
aatgccacccgggactactttatcatctgtcccatggtcaacatggccagcctctgggca
aggagaacccgtggaaatgtcttcatgtaccatgtccccgaaagctatggccatggcagc
ctagaattgctggcagatgttcaatatgcttttggactgcccttctactctgcctaccag
ggccagttttcaacggaggagcagagcctgtccctgaaagtcatgcagtatttctccaac
ttcatcagatcaggaaatcctaactacccacatgagttctcaaggaaggcagctgagttt
gccacaccttggccagactttattcctggagctggaggagagagctacaaggagctcagc
gcccagcttcccaatcggcagggcctcaaacaagctgactgctccttctggtccaagtac
atccagactctgaaggatgcagatggagccaaggatgcacagttaaccaagagtgaagag
gaagacttggaagttggacctggattagaagaagacctctcaggctcactggagcctgtc
cccaagagctacagcaaatga

DBGET integrated database retrieval system