KEGG   Mus musculus (mouse): 21823
Entry
21823             CDS       T01002                                 

Symbol
Th
Name
(RefSeq) tyrosine hydroxylase
  KO
K00501  tyrosine 3-monooxygenase [EC:1.14.16.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00350  Tyrosine metabolism
mmu00790  Folate biosynthesis
mmu01100  Metabolic pathways
mmu04728  Dopaminergic synapse
mmu04917  Prolactin signaling pathway
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
Module
mmu_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    21823 (Th)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    21823 (Th)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    21823 (Th)
  09156 Nervous system
   04728 Dopaminergic synapse
    21823 (Th)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    21823 (Th)
  09165 Substance dependence
   05030 Cocaine addiction
    21823 (Th)
   05031 Amphetamine addiction
    21823 (Th)
   05034 Alcoholism
    21823 (Th)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.2  tyrosine 3-monooxygenase
     21823 (Th)
SSDB
Motif
Pfam: Biopterin_H TOH_N
Other DBs
NCBI-GeneID: 21823
NCBI-ProteinID: NP_033403
MGI: 98735
Ensembl: ENSMUSG00000000214
Vega: OTTMUSG00000018790
UniProt: P24529
Position
7 F5; 7 88.06 cM
AA seq 498 aa
MPTPSASSPQPKGFRRAVSEQDTKQAEAVTSPRFIGRRQSLIEDARKEREAAAAAAAAAV
ASAEPGNPLEAVVFEERDGNAVLNLLFSLRGTKPSSLSRALKVFETFEAKIHHLETRPAQ
RPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSAREDKVPWFPRKVSELDKCHHL
VTKFDPDLDLDHPGFSDQAYRQRRKLIAEIAFQYKQGEPIPHVEYTKEEIATWKEVYATL
KGLYATHACREHLEAFQLLERYCGYREDSIPQLEDVSHFLKERTGFQLRPVAGLLSARDF
LASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGAS
DEEIEKLSTVYWFTVEFGLCKQNGELKAYGAGLLSSYGELLHSLSEEPEVRAFDPDTAAV
QPYQDQTYQPVYFVSESFSDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHTIRRSL
EGVQDELHTLTQALSAIS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgcccacccccagcgcctcctcgccacagcccaagggcttcagaagagccgtctcagag
caggataccaagcaggccgaggctgtcacgtccccaaggttcattggacggcggcagagt
ctcatcgaggatgcccgcaaggagcgggaggcagcagcagctgcagcagcggctgcggta
gcctccgcggaacctgggaacccattggaggctgtggtattcgaggagagggatggaaat
gctgttctcaacctgctcttctccttgaggggtacaaaaccctcctcactgtctcgggct
ttgaaagtgtttgagacatttgaagccaaaatccaccacttagagacccggcctgcccag
aggccactggcaggaagcccccacctggagtactttgtgcgcttcgaggtgcccagtggc
gacctggctgccctcctcagttctgtgcgtcgggtgtctgacgatgtgcgcagtgccaga
gaggacaaggttccctggttcccaaggaaagtgtcagagttggataagtgtcaccacctg
gtcaccaagtttgaccctgacctggacctggaccatccgggcttctctgaccaggcgtat
cgccagcgccggaagctgattgcagagattgccttccaatacaagcagggtgagccaatt
ccccacgtggaatacacaaaggaggaaattgctacctggaaggaggtatacgccacgctg
aagggcctctatgctacccatgcctgccgggaacacctggaggctttccagcttctggaa
cggtactgtggctaccgagaggacagcattccacagctggaggatgtgtctcacttcttg
aaggaacggactggcttccagctgcgacccgtggccggtctactgtctgcccgtgatttt
ctggccagtctggccttccgtgtgtttcagtgcacacagtacatccgtcatgcctcctca
cctatgcactcacccgagccagactgctgccacgagctgctgggacacgtacccatgttg
gctgaccgcacatttgcccagttctcccaggacattggacttgcatctctgggggcttca
gatgaagaaattgaaaaactctccacggtgtactggttcactgtggagtttgggctgtgt
aaacagaatggggagctgaaggcttacggtgcagggctgctgtcttcctatggagagctc
ctgcactccctgtcagaggagcccgaggtccgggcctttgacccagacacagcagccgtg
cagccctaccaagatcaaacctaccagccggtgtacttcgtgtcagagagcttcagtgat
gccaaggacaagctcaggaactatgcctctcgtatccagcgcccattctctgtgaagttt
gacccgtacaccctggccattgatgtactggacagtcctcacaccatccggcgctcctta
gagggggtccaggatgagctgcacaccctgacccaagcactgagtgccattagctaa

DBGET integrated database retrieval system