KEGG   Mus musculus (mouse): 218236Help
Entry
218236            CDS       T01002                                 

Gene name
Fam120a, C9orf10, Ossa
Definition
(RefSeq) family with sequence similarity 120, member A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 218236
NCBI-ProteinID: NP_001028440
MGI: 2446163
Ensembl: ENSMUSG00000038014
UniProt: Q6A0A9
Position
13; 13 A5
AA seq 1112 aa AA seqDB search
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGG
FYTDWVSGGQWNHMLGYLAALAKACFGGNIELFVFFNGALEKARLHEWVKRQGNERQTAQ
QIVSHVQNKGTPPPKVWFLPPVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFH
GLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAKQLDLNPNRFPIFAALL
GNHILPDEDLASFHWSLLGPEHPLASLKVRAHQLVLPPCDVVIKAVADYVRNIHDTSDLD
AIAKDVFQHSQSRTDDKVIRFKRAVGYYSATSKPMPFHPPHYLARPNPFGMPGMVPPYVP
PQMLNIPQTSLQAKPAVPQVPSPGGTPGQAPYPYSLSEPALTLDTSGKNLTEQNSYSNIP
HEGKHTPLYERSSPINLAQSGSPNHVDSAYFPGSSTSSSSDNDEGGGGATNHISGNKIGW
EKTGSHAEPLARGDPGDQVKVEGSSTASSGSQLAEGKGSHMGTVQPIPCLLSMPTRNHMD
ITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHILTKGEIKIAVSIEDEANKDLPPAALLY
RPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPLIIKEWAAYKGKSPQTPELVEAL
AFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYM
VQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIDNLDPRGIQLSALFMSGVDMALF
ANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQAEQAAKVEKMRQSI
LEGLSFSRQNHPLPFPPPPALPFYPASVYPRHFGPVPPSQGRGRGFAGVCGFGGHYGETV
ATGPYRAFRVTAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGHWAGSRR
GRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKSQGAIQGRPPYAA
SAEEVAKELKSKSGESKSSAVSLAENGVMAEEKPVPQLNGSTGDPRVPSHSESALNNDSK
PCNTNPHLNALSTDSACRREAALEAAVLNKEE
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgcagggcttccaggactacatcgagaagcactgtccgagcgccgtggtgccg
gtggagctgcagaagctggcccggggcagcctggtgggcggcgggcggcagcggcccccg
cagaccccgctgcgcctgctggtggatgccgacaactgcctgcatcgcctgtacggtggc
ttctacaccgactgggtgagcggcggccagtggaaccacatgctcggctacctggcggct
ctggccaaggcctgcttcggaggcaacatcgagctcttcgtcttcttcaatggcgcgctc
gagaaggcccggctgcacgagtgggtcaagcggcagggcaacgagcgccagacagcgcag
cagatcgtcagccatgtccagaacaagggcacgccaccgcccaaggtctggttcctgcct
ccggtctgtatggcccactgcatccgcctggcgctcatccgcttccacgtcaaggttgca
cagagcattgaggatcatcatcaagaagtgattggcttctgcagagagaatggtttccat
ggcttggtggcatatgactccgattatgcactgtgcaacatcccctactacttcagtgcc
catgccctgaaactgagccgcaacgggaagagtctcaccacaagccagtatctgatgcac
gaggttgccaagcaactggacctgaacccaaatcgttttcctatttttgctgctctgtta
ggaaatcacatactacctgatgaggatctggcttccttccattggagtttacttggtcca
gagcatccactcgcctcactgaaggtccgagcccaccagctggtcttgccaccctgtgat
gtagtgatcaaagccgtagctgattatgttcgcaacattcatgacacgtctgacctggat
gccatagctaaagatgttttccagcattcacagtcaagaacagatgacaaagtcattcgg
tttaagagagcagttggatattattcagcaactagcaagcccatgccatttcacccacca
cattacttagcccgaccaaatccatttggaatgcctgggatggtgccaccatatgttccc
cctcagatgctcaacattccacagacttctctgcaagcaaagcccgcggtcccgcaggtg
cccagcccagggggcaccccaggccaggctccatacccatacagcctctctgagccagcc
ctcaccctggacactagcgggaagaacctgacagagcagaatagctacagcaacattcct
catgaggggaagcacacaccgctgtatgagcgctcctcgcccatcaacctggcccagagt
ggcagccccaatcacgtggattctgcctacttccctggctcttctacatcatcatcatca
gacaatgatgagggcggcggaggggcgaccaaccacatcagcgggaacaagattggctgg
gagaagacaggaagccatgcagagccactggcacggggagacccaggagaccaagtaaag
gtagaaggctcatccactgcctcttcggggagccagctagctgaaggcaaagggagccat
atgggcactgttcaaccaatcccgtgcctcctgtcaatgccaactaggaaccacatggat
atcaccacacctccattgccccctgtcgcacctgaggtgttgagagtggctgagcacaga
cacaagaagggactgatgtacccctacatcttccatatcctgacaaagggtgaaatcaaa
attgctgtttctattgaagatgaagccaacaaagacctgcctccggccgccctgctctat
aggccagttcgtcagtatgtttacggagtcctgtttagtttggcagaaagcagaaagaaa
actgagagacttgcttttagaaagaacagacttccaccagaattctcgccactgatcatt
aaggagtgggcagcttacaaggggaaatctcctcagaccccggaactagtggaagcattg
gccttccgggagtggacctgccccaacctgaagaggctttggctgggcaaggcggtggag
gacaagaaccgccggatgagggccttcctggcctgcatgaggtctgataccccagccatg
ctcaaccctgccaatgtgcccactcacctcatggtgctctgctgcgtcttacggtatatg
gtgcagtggcctggagctcgcattctgcgaaggcaggagctggatgccttcctggctcag
gcattgtcccccaaactctatgagccggaccagctgcaggaactcaagattgacaactta
gacccgagaggaattcagctgtcggctctcttcatgagtggagtagacatggcactgttt
gctaatgacgcatgtggacagcccatcccctgggaacactgttgtccttggatgtatttc
gatgggaagctcttccagtccaaacttcttaaagccagcagggagaagaccccactcatc
gacctctgtgatggtcaggcggagcaggctgccaaggtggagaagatgcgccagagcatc
ctggagggcctcagcttctcccggcaaaaccacccactgcccttcccaccgcctcctgct
ctgcccttctacccagcctctgtataccctcggcactttgggccagtcccaccctcacag
ggcaggggcaggggctttgcaggagtctgtggcttcggaggccattatggggaaacagta
gcaacaggcccttaccgtgccttccgggtgacggcagcatcaggacactgtggagccttc
tcaggcagtgacagcagcaggactagcaagtcccagggcggagtccaacctattccttct
cagggagggaagctagaaatagctggcactgtggtcggccactgggctgggagcagacgg
ggccgtgggggccgagggcccttccctctgcaggtggtgtctgtgggaggaccagcgcga
gggcgtccaaggggtgttatttccactccggtgattagaacgtttggaagaggtggaagg
tactacggcagaggctacaaaagccagggagcaattcagggcaggcctccttatgctgct
tcagcagaagaagtggccaaagaactgaagtcgaaatctggggaatccaagtcctctgct
gtgtccctggctgaaaacggagtgatggccgaggagaagccagtgccccaacttaatggg
agcacgggtgaccccagagtccccagccactctgaaagtgccttgaataatgactctaaa
ccgtgcaatacaaatcctcacttaaatgcactaagtacagacagcgcctgccgcagggag
gctgctctggaggcagctgtcttaaataaagaagagtaa

DBGET integrated database retrieval system