KEGG   Mus musculus (mouse): 21825Help
Entry
21825             CDS       T01002                                 

Gene name
Thbs1, TSP-1, TSP1, Thbs-1, tbsp1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04115  p53 signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    21825 (Thbs1)
   04350 TGF-beta signaling pathway
    21825 (Thbs1)
   04151 PI3K-Akt signaling pathway
    21825 (Thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21825 (Thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21825 (Thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    21825 (Thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21825 (Thbs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21825 (Thbs1)
   05205 Proteoglycans in cancer
    21825 (Thbs1)
  09162 Cancer: specific types
   05219 Bladder cancer
    21825 (Thbs1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21825 (Thbs1)
  09174 Infectious disease: parasitic
   05144 Malaria
    21825 (Thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21825 (Thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21825 (Thbs1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21825 (Thbs1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   21825 (Thbs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC cEGF EGF_3 EGF_CA Laminin_G_2 Laminin_G_3 EGF Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 21825
NCBI-ProteinID: NP_001300843
MGI: 98737
Ensembl: ENSMUSG00000040152
Vega: OTTMUSG00000015240
UniProt: Q80YQ1 Q3TR40
Position
2 E5; 2 59.34 cM
AA seq 1170 aa AA seqDB search
MELLRGLGVLFLLHMCGSNRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFR
IENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNTGQIFSVV
SNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELD
VPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSSMVLELKGLRTIVTTLQDSIRK
VTEENRELVSELKRPPLCFHNGVQYKNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQV
CNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDKNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDLIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENFDISETDFRQF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDMKYECRDS
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctgcggggactaggtgtcctgttcctgttgcatatgtgtggaagcaaccgc
attccagagtctgggggagataacggtgtgtttgacatctttgaactcattggaggtgca
cgaaggggccccggtcgccgactggtgaagggccaagatctatccagccccgccttccgc
attgagaatgccaacctgatccccgctgtgccggatgacaagttccaagacctactggac
gctgtgtgggccgacaaaggcttcatcttcctggcttccttgaggcagatgaagaagacc
cggggcacactcctggctgtggaacggaaagacaacactggccagatcttcagtgtggtc
tccaacggcaaagctggcaccctggacctgagcctgagcctgccagggaagcaacaagtg
gtgtcagtggaggaagctctcctggccactggccagtggaagagcatcacgctgtttgtt
caagaggaccgggctcaactctacatagactgtgataagatggagagcgcggagctggat
gtacccatccagagcatcttcaccagggatctggccagcgttgccaggctccgagttgca
aagggagatgtcaatgacaattttcagggggtgctgcagaatgtgaggtttgtctttgga
accaccccagaagacattctcaggaacaaaggctgctccagctctaccaacgtccttctt
acccttgacaacaacgtggtgaacggttccagccctgctatccgcaccaactacatcggc
cacaaaacaaaggacctccaagctatctgtggcctctcctgtgatgaactatccagcatg
gtcctggaactgaagggcctgcgcaccatcgtgaccactctgcaggacagcatccgaaaa
gtgacggaagagaacagagagctggtcagtgagctgaagcggcctcccctctgctttcac
aatggagtccagtacaagaacaacgaggagtggactgtagacagttgcacagagtgtcac
tgccagaactcggttaccatctgcaaaaaggtgtcctgtcccatcatgccctgctccaac
gccacagttcctgatggtgaatgctgcccacggtgctggcccagcgactctgctgacgat
ggctggtctccctggtctgagtggacctcctgctctgccacatgtggcaatggaattcag
caacgtggtcgttcctgtgacagcctcaacaacagatgcgagggctcttcggtacagaca
aggacctgccacattcaggagtgtgacaaaagatttaaacaggatggtggctggagtcac
tggtctccatggtcgtcctgttctgtgacctgtggtgacggtgtgatcacaaggatccgg
ctctgcaactcccccagcccccagatgaacgggaagccctgtgaaggtgaagcccgggag
accaaagcctgcaagaaagacgcctgcccaattaatggaggctggggtccctggtcacca
tgggacatctgctctgtcacctgtggaggaggagtgcagagacgcagccgactctgtaac
aaccccacaccccagtttggaggcaaagactgtgttggcgatgtgacagaaaatcaagtt
tgcaacaagcaggactgcccaattgatggatgcctgtccaatccctgctttgctggtgcc
aagtgtactagctaccctgatggtagctggaaatgtggtgcgtgtcctcctggctacagt
ggaaatggcatccagtgcaaagacgtcgatgagtgcaaagaagtgcctgatgcttgcttc
aatcacaacggagaacatcggtgcaagaacacagatcctggctacaactgcctgccctgc
ccaccacgattcactggctcacagcccttcggccgaggtgtcgaacatgccatggccaac
aaacaggtgtgcaaaccgcgaaacccctgcacggacgggacgcatgactgcaacaagaac
gctaagtgcaactacctgggtcactacagtgaccccatgtaccgctgtgagtgcaagccc
ggctatgcaggcaatggcatcatctgcggagaggacacagacctggacggctggcctaat
gaaaacctggtgtgtgtggccaacgcaacctaccactgcaaaaaggacaactgccccaac
cttcccaactcggggcaggaagactatgacaaggacgggattggcgatgcctgcgatgat
gacgatgacaacgacaagatccccgatgacagggacaactgtccattccattacaaccca
gcccagtatgactatgacagagatgatgtgggagaccgctgtgacaactgcccctacaac
cacaaccctgaccaagcagacacagacaaaaacggggagggcgatgcctgtgctgtggac
atcgatggagatggaatcctcaatgaacgagacaactgccagtacgtttacaacgtggac
cagagggacacggacatggatggggttggagatcagtgtgacaactgccccctggaacac
aatccagaccagctggactctgactcagacctcataggggacacttgtgacaacaatcag
gacatcgatgaggatggccatcagaacaatctggacaactgtccctatgtgcctaatgcc
aaccaggccgaccatgataaagatggcaaaggagatgcctgtgaccatgacgatgacaat
gacggcatccctgatgacagagacaactgcaggctggtgcccaatcctgaccagaaggac
tctgatggtgatggccgaggtgacgcctgcaaagacgactttgaccatgacaatgtgcca
gatattgatgacatctgtcctgagaattttgacatcagtgaaaccgatttccgacaattc
cagatgattcctctagatcccaaaggaacctcccaaaatgaccctaactgggttgtccgc
catcagggcaaagaacttgtccagactgtaaactgtgaccctggacttgctgtaggttat
gatgagtttaatgctgtggacttcagcggtaccttcttcatcaacaccgagagagatgat
gactacgctggctttgttttcggctaccagtccagcagccgcttctacgttgtgatgtgg
aaacaagtcacccagtcctactgggacaccaaccccacaagggctcagggatactcaggc
ctgtctgtaaaggttgtgaactccaccaccggccctggcgagcacctgcggaatgcactg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgccacatc
ggctggaaagatttcactgcatacagatggcgtctcagccacaggccaaagaccggttat
atcagagtggtgatgtatgaaggaaagaaaatcatggctgactcgggacccatctatgac
aaaacctacgccggcggtagactaggcctgttcgtcttctctcaggaaatggtgttcttc
tcagacatgaaatacgagtgtcgagattcctaa

DBGET integrated database retrieval system