KEGG   Mus musculus (house mouse): 21827
Entry
21827             CDS       T01002                                 
Symbol
Thbs3, TSP3, Thbs-3
Name
(RefSeq) thrombospondin 3
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21827 (Thbs3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21827 (Thbs3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21827 (Thbs3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21827 (Thbs3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21827 (Thbs3)
  09174 Infectious disease: parasitic
   05144 Malaria
    21827 (Thbs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21827 (Thbs3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21827 (Thbs3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21827 (Thbs3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21827 (Thbs3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21827 (Thbs3)
  Exosomal proteins of colorectal cancer cells
   21827 (Thbs3)
  Exosomal proteins of bladder cancer cells
   21827 (Thbs3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21827 (Thbs3)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 cEGF EGF
Other DBs
NCBI-GeneID: 21827
NCBI-ProteinID: NP_038719
MGI: 98739
Ensembl: ENSMUSG00000028047
UniProt: Q05895
Position
3:89122470..89134148
AA seq 956 aa
MEKPELWGVLALLLLCSYTCGSQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSPGLQLYVDCKLGDQHAGLPALAPIPPAEVSGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDDSIHNAVTSALQSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPSPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCDDINECAHADPCFPGSSCINTMPGFHCEACPPGYKGTRVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCVPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYIPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSISG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWRLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggagaagccggaactttggggtgtcctggctctcctcctcctctgctcttacacgtgt
ggcagtcaggaccttcaggtaattgacctgctgacagtgggcgaatccaggcagatggta
gctgtggcagagaagattcggacagctttactcactgctggggatatctacctcttgtcc
actttccgcctccctccaaagcaaggtggtgtcctctttggcctctactctcgccaagac
aacacacgatggctggaggcctctgttgtgggcaagatcaacaaagtgctggtgcggtac
cagcgggaagatggcaaagtccatgcagtgaacctacagcaagcaggcctggctgatggg
cgcacacacacggctctcctgcgactccgaggaccttctcgacccagccctggcctgcag
ctgtatgtggactgtaaactgggtgaccaacatgctggccttccagcactggccccgatc
cctccagcagaggtcagtggactggagattagaactggacaaaaggcttatctgaggatg
cagggctttgtggaatcgatgaaaattattctgggtggatccatggctcgggtaggagcc
ctgagtgaatgtccattccaaggagacgactccattcacaatgcagtgaccagcgcactg
caatccattctaggggagcagaccaaggcattggtcacccagctcaccctcttcaaccag
atcctagtggagcttcgggacgacatccgagaccaggtgaaggaaatgtcactcatccgg
aacaccatcatggagtgtcaggtgtgcggtttccacgagcagcgttcacactgcagcccc
agcccctgcttccgaggcgtggactgtatggaagtgtatgagtacccgggctatcgctgt
gggccctgcccacctggcctgcagggcaatggcacccactgtgatgacatcaacgagtgt
gctcacgctgacccctgtttcccggggtccagctgcatcaacaccatgcctggcttccac
tgcgaggcctgtcctccagggtacaagggcacccgagtgtctggtgtgggcatcgactat
gctcgagccagcaaacaggtctgcaatgacattgatgaatgtaatgatggtaacaacgga
ggctgtgacccaaattccatctgcaccaacacggtggggtctttcaaatgtggtccctgc
cgcctgggtttcctggggaaccagagccagggctgcgttccagcaaggacctgccacagc
cctgcccacagcccctgccacatccacgcccactgtctctttgaacgcaatggcgctgtg
tcatgccagtgtaacgtgggctgggcagggaatgggaacgtgtgtgggcctgacacagat
atagacggctatccggaccaggctcttccctgcatggataacaacaagcactgcaagcag
gacaattgccttttgacacccaactctgggcaagaagatgctgataacgatggtgtcggg
gaccagtgtgatgacgatgctgacggggatggtatcaagaatgtggaggacaattgtcga
ctgttccccaacaaggaccagcagaattcagacacagactcgtttggtgatgcctgcgac
aactgtcccaatgttcccaacaatgaccagaaggacacggatggcaatggagaaggagat
gcctgtgacaacgatgtggacggggatggcatccccaacgggttggacaattgccctaaa
gtacccaacccactgcagacagaccgggatgaagacggagtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagcgacctggtgggggatgtc
tgtgacaccaacgaagacagcgacggagacgggcaccaggacaccaaggacaactgtcct
cagctgccaaatagctctcagctggactcagacaatgacgggcttggagatgagtgtgac
ggggacgatgacaatgacggtgtcccagattacattcctcccgggcctgataactgtcgc
ctggtacccaatcctaatcagaaggactcagatggcaacggtgtgggtgatgtctgtgaa
gatgactttgacaatgacgcagtggttgaccctctggatgtgtgcccggagagtgcagaa
gttaccctcacagacttccgggcctatcagactgtgatcctggatcccgagggtgacgcc
cagatcgatccaaactgggtagtgctcaaccagggcatggaaattgttcagactatgaac
agtgacccgggtcttgcagttgggtacacggcctttaatggcgtggactttgaaggcacc
ttccacgtgaacacagtcactgatgatgactatgcgggcttcctcttcagttaccaggac
agtggccgcttctatgtggtcatgtggaaacagacggagcagacctactggcaggccacg
cctttccgagcagtggcccaaccagggcttcagctcaaggcagtgacatccatatctggc
ccaggtgagcacctccggaatgctctgtggcatactggccacacccctgatcaggtacga
ctgctgtggactgacccacggaatgtgggttggcgagacaagacatcctatagatggcgg
ctgctccaccggccccaagttggctacattcgggtgaagctctatgagggtccccagcta
gtggcggattctggggtgattattgacacgtccatgcgaggggggcgtctcggcgtattc
tgcttctcccaagaaaacatcatttggtccaatctccagtaccgatgcaatgacacagtg
cctgaggactttgagccattccggaggcagctgctccagggaagagtgtga

DBGET integrated database retrieval system