KEGG   Mus musculus (mouse): 21832Help
Entry
21832             CDS       T01002                                 

Gene name
Thpo, Mgdf, Ml, Mpllg, Tpo
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    21832 (Thpo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21832 (Thpo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    21832 (Thpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21832 (Thpo)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   21832 (Thpo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 21832
NCBI-ProteinID: NP_001166976
MGI: 101875
Ensembl: ENSMUSG00000022847
Vega: OTTMUSG00000021017
UniProt: P40226 Q543R9
Position
16 B1; 16 12.51 cM
AA seq 356 aa AA seqDB search
MELTDLLLAAMLLAVARLTLSSPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPV
LLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRL
LLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTT
AVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRS
PVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDISPGAFNKGSLAFNLQGGLPPSPSLA
PDGHTPFPPSPALPTTHGSPPQLHPLFPDPSTTMPNSTAPHPVTMYPHPRNLSQET
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagctgactgatttgctcctggcggccatgcttcttgcagtggcaagactaactctg
tccagccccgtagctcctgcctgtgaccccagactcctaaataaactgctgcgtgactcc
cacctccttcacagccgactgagtcagtgtcccgacgtcgaccctttgtctatccctgtt
ctgctgcctgctgtggactttagcctgggagaatggaaaacccagacggaacagagcaag
gcacaggacattctaggggcagtgtcccttctactggagggagtgatggcagcacgagga
cagttggaaccctcctgcctctcatccctcctgggacagctttctgggcaggttcgcctc
ctcttgggggccctgcagggcctcctaggaacccagcttcctctacagggcaggaccaca
gctcacaaggaccccaatgccctcttcttgagcttgcaacaactgcttcggggaaaggtg
cgcttcctgcttctggtagaaggtcccaccctctgtgtcagacggaccctgccaaccaca
gctgtcccaagcagtacttctcaactcctcacactaaacaagttcccaaacaggacttct
ggattgttggagacgaacttcagtgtcacagccagaactgctggccctggacttctgagc
aggcttcagggattcagagtcaagattactcctggtcagctaaatcaaacctccaggtcc
ccagtccaaatctctggatacctgaacaggacacacggacctgtgaatggaactcatggg
ctctttgctggaacctcacttcagaccctggaagcctcagacatctcgcccggagctttc
aacaaaggctccctggcattcaacctccagggtggacttcctccttctccaagccttgct
cctgatggacacacacccttccctccttcacctgccttgcccaccacccatggatctcca
ccccagctccaccccctgtttcctgacccttccaccaccatgcctaactctaccgcccct
catccagtcacaatgtaccctcatcccaggaatttgtctcaggaaacatag

DBGET integrated database retrieval system