KEGG   Mus musculus (mouse): 21833
Entry
21833             CDS       T01002                                 

Gene name
Thra, 6430529J03Rik, AW259572, Erba, Nr1a1, Rvr, T3R[a], T3Ralpha, Thra1, Thra2, c-erbA-1, c-erbA-alpha, c-erbAalpha
Definition
(RefSeq) thyroid hormone receptor alpha
  KO
K05547  thyroid hormone receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    21833 (Thra)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    21833 (Thra)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21833 (Thra)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    21833 (Thra)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    21833 (Thra)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1A. Thyroid hormone receptor (THR)
   21833 (Thra)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 21833
NCBI-ProteinID: NP_001300912
MGI: 98742
Ensembl: ENSMUSG00000058756
Vega: OTTMUSG00000006409
UniProt: P63058
Position
11 D; 11 62.58 cM
AA seq 492 aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLRGPVLQHQSPKSPQQRLLELLHRSGILHSRAVCGEDDSSEASSLSSSSDTEDTE
VCEDQAGKAASP
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggaacagaagccaagcaaggtggagtgtgggtcagacccagaggagaacagtgccagg
tcaccagatggaaagcgaaaaagaaagaacggccaatgtcccctgaaaagcagcatgtca
gggtatatccctagttacctggacaaagacgagcagtgtgtcgtgtgtggggacaaggcc
accggttatcactaccgctgtatcacttgtgagggctgcaagggcttctttcgccgcaca
atccagaagaatctccatcccacctattcctgcaagtatgacagctgctgtgtcatcgac
aagatcacccggaatcagtgccagctgtgccgcttcaagaagtgcattgctgtgggcatg
gccatggacttggttctagatgattcgaagcgggtggccaaacgcaagctgattgagcag
aaccgggagaggaggcgaaaggaggagatgattcgctcactgcagcagcgaccagagccc
actcctgaagagtgggacctgatacatgttgctacagaggcccatcgcagcactaacgcc
cagggcagccattggaaacagaggcgaaaattcctgccggatgacattggccagtcacct
attgtctccatgccggacggagacaaggtagacctagaggccttcagcgagtttaccaag
atcatcaccccggccatcacgcgcgtggtggactttgccaaaaaactgcccatgttctcc
gagctgccttgcgaagaccagatcatcctcctgaagggctgctgcatggagatcatgtcc
ctgcgggcagctgtccgctacgaccctgagagtgacaccctgaccctgagtggggagatg
gcggttaagcgggaacagctcaagaatggtggcttgggtgtggtctctgacgccatcttt
gaactgggcaagtcactctctgcctttaacctggatgacacggaagtggctctgctgcag
gctgtgctgctaatgtcaacagaccgctccggcctgctgtgcgtggacaagatcgagaag
agtcaggaggcctacctgctggcgtttgagcactacgtcaaccaccgcaaacacaacatt
ccgcacttctggcccaagctgctgatgaaggagagagaagtgcagagttcgattctgtac
aagggggcagcggcagaaggccggccgggcgggtcactgggcgtccacccggaaggacag
cagcttctcggaatgcatgttgttcagggtccgcaggtccggcagcttgagcagcagctt
ggtgaagcgggaagtctccgagggccggttcttcagcaccagagcccgaagagcccgcag
cagcgtctcctggagctgctccaccgaagcggaattctccattcccgagcggtctgtggg
gaagacgacagcagtgaggcgagctccctgagctcctcctctgacacggaggacacggag
gtctgcgaggaccaggcaggcaaggcagcctctccctga

DBGET integrated database retrieval system