KEGG   Mus musculus (mouse): 21838
Entry
21838             CDS       T01002                                 

Gene name
Thy1, CD90, T25, Thy-1, Thy-1.2, Thy1.1, Thy1.2
Definition
(RefSeq) thymus cell antigen 1, theta
  KO
K06514  Thy-1 cell surface antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    21838 (Thy1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21838 (Thy1)
   04090 CD molecules [BR:mmu04090]
    21838 (Thy1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    21838 (Thy1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21838 (Thy1)
CD molecules [BR:mmu04090]
 Proteins
  21838 (Thy1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  21838 (Thy1)
SSDB
Motif
Pfam: ig V-set Ig_3 I-set
Other DBs
NCBI-GeneID: 21838
NCBI-ProteinID: NP_033408
MGI: 98747
Ensembl: ENSMUSG00000032011
Vega: OTTMUSG00000016734
UniProt: P01831
Position
9 A5.1; 9 24.52 cM
AA seq 162 aa
MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKR
KHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKS
ISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaacccagccatcagcgtcgctctcctgctctcagtcttgcaggtgtcccgagggcag
aaggtgaccagcctgacagcctgcctggtgaaccaaaaccttcgcctggactgccgccat
gagaataacaccaaggataactccatccagcatgagttcagcctgacccgagagaagagg
aagcacgtgctctcaggcacccttgggatacccgagcacacgtaccgctcccgcgtcacc
ctctccaaccagccctatatcaaggtccttaccctagccaacttcaccaccaaggatgag
ggcgactacttttgtgagcttcaagtctcgggcgcgaatcccatgagctccaataaaagt
atcagtgtgtatagagacaagctggtcaagtgtggcggcataagcctgctggttcagaac
acatcctggatgctgctgctgctgctttccctctccctcctccaagccctggacttcatt
tctctgtga

DBGET integrated database retrieval system