KEGG   Mus musculus (house mouse): 21841
Entry
21841             CDS       T01002                                 
Symbol
Tia1, 2310050N03Rik, AI256674, TIA-1, mTIA-1
Name
(RefSeq) cytotoxic granule-associated RNA binding protein 1
  KO
K13201  nucleolysin TIA-1/TIAR
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    21841 (Tia1)
   03041 Spliceosome [BR:mmu03041]
    21841 (Tia1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     21841 (Tia1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    21841 (Tia1)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_7 Nup35_RRM_2 Calcipressin DbpA Nup35_RRM XOO_2897-deam Flg_new_2
Other DBs
NCBI-GeneID: 21841
NCBI-ProteinID: NP_035715
MGI: 107914
Ensembl: ENSMUSG00000071337
UniProt: P52912 Q564E7
Structure
Position
6:86381001..86410387
AA seq 386 aa
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAA
AALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTE
DIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN
WATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQI
MEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQI
GYPPTYGQWGQWYGNAQQIGQYVPNGWQVPAYGVYGQPWSQQGFNQTQSSAPWMGPNYSV
PPPQGQNGSMLPSQPAGYRVAGYETQ
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaggacgagatgcccaagactctatacgtcggtaacctttctcgagatgtgacagaa
gctctcatcctccagctctttagccagattggaccttgtaaaaactgcaaaatgattatg
gatacagcaggaaatgacccatactgttttgtggagttccatgagcaccgtcatgcagct
gcagccctggctgccatgaatgggcggaagataatgggtaaggaagtgaaagtgaattgg
gcaacaacccctagcagtcaaaagaaggatacgagcagtagtaccgttgtcagcacacag
cgttcacaagatcatttccatgtgtttgttggtgacctcagtccagaaatcacaaccgaa
gacatcaaagcagcgtttgcaccatttggaagaatttcagatgcccgtgtggtaaaagac
atggctaccgggaagtctaagggatatggctttgtctcctttttcaacaaatgggatgca
gaaaatgccattcagcagatgggtggccagtggcttggtggaagacaaatcagaactaac
tgggcaacccgaaagcctccagctccaaagagtacatatgagtcgaacaccaaacagctg
tcatatgatgaggttgtgagtcagtctagtcccaacaactgcactgtgtactgtggaggg
gtgacgtcaggactgacagaacaactaatgcgtcagactttttctccatttggacaaata
atggaaattcgagtcttcccagataaaggatactcatttgttcggttcagttcccatgaa
agtgcagcacatgcgattgtttctgttaatggtactaccattgaagggcatgtggtgaaa
tgttattggggcaaagagactcttgatatgataaaccctgtgcaacagcaaaatcaaatt
ggatatccaccaacatatggccagtggggccagtggtatggaaatgcacaacagattggc
cagtatgtgcctaacggttggcaagtacctgcctatggagtgtatggccagccatggagc
cagcaggggttcaatcagacccagtcttctgcaccgtggatgggacccaattacagtgtg
ccaccacctcaagggcagaatggcagcatgttgcctagtcagcctgctgggtatcgagtg
gccgggtatgaaacccagtga

DBGET integrated database retrieval system