KEGG   Mus musculus (mouse): 21844
Entry
21844             CDS       T01002                                 

Gene name
Tiam1, AI847750, D16Ium1, D16Ium10, D16Ium10e
Definition
(RefSeq) T cell lymphoma invasion and metastasis 1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04530  Tight junction
mmu04810  Regulation of actin cytoskeleton
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    21844 (Tiam1)
   04015 Rap1 signaling pathway
    21844 (Tiam1)
   04024 cAMP signaling pathway
    21844 (Tiam1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    21844 (Tiam1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    21844 (Tiam1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    21844 (Tiam1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    21844 (Tiam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21844 (Tiam1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   21844 (Tiam1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PH_9 PDZ PDZ_6 PDZ_2 PH_11
Other DBs
NCBI-GeneID: 21844
NCBI-ProteinID: NP_001139358
MGI: 103306
Ensembl: ENSMUSG00000002489
Vega: OTTMUSG00000024287
UniProt: G3UWG2 Q6P1D6 Q3UHH6 Q3UVX2
Structure
PDB: 
1FOE 3A8N

Position
16 C3.3; 16 51.5 cM
AA seq 1591 aa
MGNAESQNVDHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKAIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGALDDFGDPIWVDRVDMGLRPVSYTDSSVTPSVDGSIVLTA
ASVQSMPDSEESRLYGDDATYLAEGGRRQCPYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETEASPRQLSTCQRANSLGDLYAQKN
SGVKANGGPRNRFSSYCRNLVSDIPDLAKHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISLSKSMQGRRAKTTQDVNTGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYETD
GRSGIDHNSVPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGEIGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPTINQVFGEGT
DAVKRSLEGIFDDTVPDGKREKEVVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLMENRVQFYIPQPEEDIYELLYKEIEICP
KVTQNIHIEKSDAAADNYGFLLSSVDEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAAGTLNSSMLKDFLSQPSLGLLVRTYPEPEGGVELLENPPHRVDGPVDLGESPLAFLTS
NPGHSLSSEQGSSAETAPEEGEGPDLESSDETDHSSKSTEQVAAFCRSLHEMSPSDSSPS
PQDATSPQLATTRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKSVHSILRDKHRRQLLKTESLPSAQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPEKEPQQPAGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESLKGASVDRDLQEQLQAASISQRARGRRTLDSHASRMTQLKKQAALS
GINGGLESASEEVIWVRREDFAPSRKLNTEI
NT seq 4776 nt   +upstreamnt  +downstreamnt
atgggaaacgcagaaagccaaaatgtagaccacgagttttatggagaaaagcatgccagc
ctggggcggaagcacacttcacgctccctgcggctgtcacacaagacccggaggacacgg
catgcttcctccgggaaggcgatccacaggaactctgaagtgagcacccggtccagcagc
acgcccagcatcccccagtccctggctgaaaatggcctggagcccttctcccaagaaggc
gccctagacgacttcggggaccccatctgggtggaccgagtagatatgggcttgagaccc
gtatcttacaccgattcttccgtcactcccagcgtagatggcagcatcgtcctcactgca
gcctctgtgcagagcatgccagactcagaggagagccggctttacggggatgacgctacg
tacttggctgagggaggcaggaggcagtgtccctatacatccaatgggcccacattcatg
gagacagcgagctttaagaagaagcgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactctcagatctgagccaagaacatttaacaagcaacgaagaaatcttg
ggttccgcggaagagaaggattgcgaggaggctcgggggatggaaacagaggcgagtccc
cggcagctcagcacctgtcagcgagccaactccctgggtgacttgtatgctcagaaaaac
tctggggtgaaggctaatggaggaccgaggaacagattctcaagctactgccggaatttg
gtgtcggatattcccgatcttgcaaagcataagatgccaccggctgctgccgaagagact
cctccgtacagtaattacaacacgcttccctgtaggaagtcgcactgtctttccgagggt
gccaccaacccacaaattagccttagcaagagcatgcaaggcagaagagcaaaaaccacc
caggatgttaacacaggcgagggcagcgagtttgcggacagtgggatcgaaggggccacc
accgacacggacctcttgtccaggagatccaatgccaccaactcaagctactcgcccccc
acaggccgagcctttgtgggcagcgacagcggcagcagttcaacaggggatgctgcgcgc
cagggggtgtacgagaacttcaggcgggaactggagatgagtaccaccaacagtgagagc
ctggaggaggctggctctgcgcacagcgatgagcagagcagcggaaccctcagttccccg
ggccagtcggacatcctgctaacggctgcgcagggcactgtgcggaaggctggagcgctg
gcagtcaagaacttcctggtccacaagaagaataagaaggtggagtcggctacccggagg
aagtggaagcactactgggtgtccctgaaaggttgcacgctctttttctatgagactgat
ggcaggtctgggatagaccacaacagtgtccccaagcacgccgtctgggtggagaacagc
atcgtgcaggctgtgcctgagcaccccaagaaagacttcgtcttctgcctcagcaactcc
ctgggtgacgccttcctcttccagaccacgagccagacagagctggagaactggatcacc
gccatccactctgcctgcgcagctgccgtcgcaaggcaccaccacaaggaggacacgctc
cgcctcctcaagtcggaaatcaagaagctggagcagaagatcgacatggacgagaagatg
aagaagatgggggagatgcagctgtcttccgtcaccgactcgaagaagaagaagaccatc
ctagaccagatcttcgtttgggagcagaacctcgaacagttccagatggacctgttccga
ttccgctgttacctcgccagcctccagggcggggagctgccaaaccccaaaaggctgctt
gcttttgcgagccggcccacgaaggtggccatgggccgcctcgggatcttctccgtgtca
tcttttcatgccctggtggcagcccggactggtgagatcggagtgagaaggcgtactcag
gccatgtccaggtctgcaagcaagcgaaggagcaggttttcttctctctggggcctagac
actacctccaaaaagaagcagggacgcccaaccatcaaccaggtgtttggagaggggact
gatgctgtaaagagatctttagagggaatatttgatgacactgttccagatggcaagagg
gagaaggaagtggtcttacccagtgtccaccagcacaaccccgactgtgacatttgggtc
catgaatatttcactccatcctggttctgtctacccaacaaccagccagccttgacggtt
gtccggccaggggacactgcgagggacaccttggagctcatttgcaagacacatcaactg
gatcattccgcccattacctgcgcctgaaattcctaatggagaacagagtgcagttctac
atcccgcagcccgaggaggacatttacgagctgctttacaaagaaattgaaatctgtcca
aaagtcacccagaatatccacattgagaagtcagacgcggccgctgataattacgggttt
ttgctttcttctgtggatgaagatggcattcgaaggctctacgtgaacagtgtcaaggaa
accgggttagcttccaagaaaggcctgaaggcgggggatgagattctcgagatcaataat
cgtgctgctggtaccctgaactcatctatgctcaaagatttcctctcacagccctccctg
ggcctcctggtgaggacctaccctgagccagagggaggcgtggagctgctggagaaccct
ccgcaccgagtggacggccctgtggaccttggcgagagccccctcgccttcctcaccagc
aacccagggcacagcctctccagtgagcagggcagcagtgctgagacagctccagaagag
ggcgaaggaccggacttggagtcttctgatgagacagatcacagcagcaagagcacagaa
caggttgcagcgttttgccggagtctgcacgagatgagcccctctgactcaagcccgtcc
cctcaggatgccacaagccctcagctggcaaccacacgacagctgtcggatgcggataag
ctgcgcaaggtgatctgtgaactgctggagactgaacgcacctatgtgaaagacttaaac
tgcctcatggagagatacctgaagccccttcagaaggagacctttctcacccaggatgag
cttgatgtactttttggaaatttaaccgaaatggtggagtttcaagtcgagttccttaag
actctagaagatggagtaagactggtccctgacttggaaaagctggagaaggttgaccag
ttcaagaaagtgctcttctctctggggggatccttcctgtactacgcggaccgcttcaag
ctctacagtgccttctgtgcgagccacacaaaagtccccaaggtcctggtgaaagccaag
acggacacagccttcaaggcgttcctcgatgcccagaacccgaggcagcagcactcatcc
acgctggagtcttacctcatcaagcccatccagagggtcctcaagtacccgcttctgctc
agggagctgtttgcgctgaccgatgcggagagcgaggaacactaccacctggacgtggcc
atcaagactatgaacaaggtcgccagtcacatcaatgagatgcagaagatccacgaagag
tttggtgctgtgtttgaccagctgattgctgagcagacgggagagaagaaagaggttgca
gatctgagcatgggtgacctgctcttgcacaccagcgtcatctggctgaacccacccgcc
tcactgggaaagtggaaaaaggagccagaattagcagccttcgtcttcaaaacggccgtg
gtccttgtatataaagacggttccaagcagaagaagaaacttgttggctctcacaggctg
tcaatctacgaggagtgggaccctttccggtttcgccacatgatccctaccgaagctttg
caggtccgagctctgcccagtgcagatgcagaggcaaatgcggtatgcgaaattgtccac
gtgaaatcagagtcagaagggaggcccgagcgggttttccacctctgctgcagttcccca
gagagcagaaaggactttctgaagtctgtgcattcgatcctgcgagataaacacagaaga
cagctcctcaaaacggaaagccttccgtcagcccagcagtatgtcccctttggaggcaag
agattgtgtgcgcttaaaggcgccaggccggccatgagcagggcagtgtctgccccaagc
aagtctcttgggaggaggaggcggcgactggcccgaaacaggtttaccatcgattcagac
gccatctcagccagcagcccggagaaagagccccagcagcccgccggtggtggggacact
gaccgatgggtagaggaacagttcgatcttgctcagtacgaggagcaggatgacatcaag
gagacagacatcctcagtgacgatgacgaattctgtgagtccctgaagggcgcctcagtg
gacagagaccttcaggagcagcttcaggctgcctccatcagtcagcgggcccgaggccgg
agaaccctcgatagccacgcctcccgcatgacacagctcaagaagcaagcggccctctcg
ggcatcaacgggggcctggagagtgcgagcgaggaagtcatttgggtcaggcgcgaagac
tttgccccctccaggaaactgaacacggagatatga

DBGET integrated database retrieval system