KEGG   Mus musculus (mouse): 218454
Entry
218454            CDS       T01002                                 

Symbol
Lhfpl2, 6030465B15, AI447312, AW050335, mKIAA0206, vg, vgim
Name
(RefSeq) lipoma HMGIC fusion partner-like 2
  KO
K23893  LHFPL tetraspan subfamily member protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    218454 (Lhfpl2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   218454 (Lhfpl2)
SSDB
Motif
Pfam: L_HMGIC_fpl Claudin_2 Nucleos_tra2_C PMP22_Claudin Sdh_cyt Claudin_3
Other DBs
NCBI-GeneID: 218454
NCBI-ProteinID: NP_766177
MGI: 2145236
Ensembl: ENSMUSG00000045312
Vega: OTTMUSG00000027714
UniProt: Q8BGA2
Position
13; 13 C3
AA seq 222 aa
MCHVIVTCRSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGSGDEQAGMNSEPHYLGI
LCIRTPAMQQVSRDTLCGTYAKSFGEIASGFWQATAIFLAVGIFILCVVALVSVFTMCVQ
SIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDCGRYASPYKPGDCSLGWAFY
TATGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLVCLL
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgtcatgtcattgtcacctgccgctcgatgctctggaccctcctgagtatcgtggtg
gcctttgctgagctcgttgccttcatgagcgccgactggctgatcgggaaagccaagacc
cgcagcggcagtggcgatgagcaggcaggcatgaactcggagccccactacctgggcatc
ctctgcatccgtacccctgccatgcagcaagtctctcgggacacactgtgcgggacctac
gccaagagcttcggggagatagccagcggcttctggcaggctaccgctattttcctggcc
gtggggatcttcattctctgcgtagtggccttggtgtccgtcttcaccatgtgcgtgcaa
agcatcatgaggaaaagcattttcaacgtctgcgggctcctacagggaatcgcaggtctg
ttccttatcctcggcctgatcctctaccccgcaggctggggctgccagaaagccatagac
tgtggacggtatgcgtccccctacaaacctggagactgctccctgggctgggccttctat
actgccaccgggggcacggtcctcacctttatctgtgctgtcttctctgcacaagcagaa
attgcaacctccagtgacaaagtccaggaagaaattgaagaggggaaaaacctcgtctgc
ctcctttaa

DBGET integrated database retrieval system