KEGG   Mus musculus (mouse): 218503
Entry
218503            CDS       T01002                                 

Symbol
Fcho2, 5832424M12Rik, AA387320
Name
(RefSeq) FCH domain only 2
  KO
K20042  F-BAR domain only protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    218503 (Fcho2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    218503 (Fcho2)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    218503 (Fcho2)
SSDB
Motif
Pfam: muHD FCH DUF1664 Prominin
Other DBs
NCBI-GeneID: 218503
NCBI-ProteinID: NP_766179
MGI: 3505790
Ensembl: ENSMUSG00000041685
UniProt: Q3UQN2
Position
13:complement(98859914..98953085)
AA seq 809 aa
MVMAHFVENFWGEKNNGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSA
SNYSQLGTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVA
GTLEAVQAIQNITQALQKSKENYTAKCVEQERLKKEGATQREIEKAAVKSKKATDTYKLY
VEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQVHEEFIN
NMANTTIESLIQKFAESKGTGKERPGLIEFEECDPASAVEGIKPRKRKTFALPGIIKKEK
DAESVECPDADSLNIPDVDEEGFSIKPEANQNDTKENHFYSSSDSDSEDEEPKRYRIEIK
PAHPNNLHHTMASLDELKVSIGNITLSPAVSRHSPVQMNRNSSNEELTKSKPSSLPTEKG
TNDLLAWDPLFGSSLESSSAPLTSSSSARPTTPLSLGTLVPPPRPASRPKLASGKLSGIN
EIPRPFSPPVTSNTSPPPTAPLARAESSSSISSSASLSAANTPTVGVSRGPSPVSLGNQD
TLPVAIALTESVNAYFKGADPTKCIVKITGDVTISFPSGIIKVFTSNPSPAVLCFRVKNI
SRLEQILPNSQLVFSDPSQCDSNTKDFWMNMQAVTIYLKKLSEQNPAASYYNVDVLKYQV
SSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAMVAPSVLSNIQVVVPVDGGVTNMQS
LPPAIWNAEQMKAFWKLSGISEKSDSGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGNTLS
GVDIELVGTGYRLSLVKKRFATGRYLADC
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggtcatggcgcatttcgtggagaatttctggggggaaaaaaataatggctttgatgta
ctgtaccataatatgaagcatggacagatatcaactaaagaactagcagattttgtaaga
gaaagagctacaatagaagaggcatactccagatcaatgacaaaactagcgaaatctgca
agcaattattcacaacttggaacatttgcaccaatgtgggatgtattcaaaacatctaca
gagaaattagcaaattgtcatttggatcttgttagaaaattacaggaattaataaaggaa
gttcagaagtatggagaggagcaagtcaagtctcataagaagactaaagaagaagtcgca
gggactctggaagcagtccaagccattcagaatataactcaggcactccagaagtcgaag
gaaaattacactgccaaatgtgtagaacaggaacgtctgaaaaaggaaggagctacacaa
agagaaatagaaaaggcagctgttaagtctaagaaagctacagatacttataaactttat
gtggaaaagtatgcattaacaaaagcagattttgagcagaagatgacagaaacagcccag
aaatttcaagatattgaagaaactcacctcattcacataaaggaaattatcggatccttg
tcaaatgctgtcaaggagatccacttacagatcggccaggttcatgaagagtttataaat
aacatggctaatactacaattgaaagtttgattcagaaatttgccgagtcaaaaggcaca
gggaaggaaagacctggtcttattgaatttgaagagtgtgaccctgctagtgcagttgaa
ggcataaaaccaaggaaaagaaagacttttgctttgcctggaataattaaaaaggaaaag
gacgcagaatctgtggaatgtcctgatgcagattcgcttaatattccagatgtagatgaa
gaaggtttcagtattaaaccagaagcaaatcagaatgataccaaagagaaccatttctac
tcatccagtgactctgactctgaagatgaagaaccaaagaggtaccggatagagatcaag
cccgcgcatccaaataacttgcatcacacaatggcttctttggatgaactgaaagtatcc
atagggaatataacattgtccccagcagtatctagacacagtccagtgcagatgaatcgg
aattcatctaatgaagaattaacaaaatcaaagccgtcttctctacccactgagaaaggg
accaatgatttacttgcttgggatcccctgttcggatcgtcgcttgagtcatcttcagct
ccactaacttcgtcatcatcggccagacccacgacacctctctctttaggcacccttgtt
ccacctccaaggcctgcttccagaccaaagcttgcttcaggaaaactgagtgggatcaat
gaaatacccaggccattcagcccacctgtaacttccaacaccagcccacctcctactgct
cccttagcccgagccgagagcagctcctctatctcctcgtctgcctcgttgagtgctgcc
aacactccaacagtaggtgtatcacggggtcccagcccggtcagccttggaaaccaggac
actttacctgtggcaatcgcccttacagaatctgtcaacgcctactttaaaggagcagat
cctaccaagtgtattgtgaagatcacgggagacgtgacaatatcatttcccagtgggatt
attaaagtcttcaccagcaacccctccccagctgtgctgtgctttagggtgaagaacatc
agcaggctggagcagatccttccaaactcccagcttgtgttcagtgatccatcacagtgt
gattccaacacaaaagatttttggatgaacatgcaagctgttactatctacctcaagaag
ctatcagaacaaaatccagctgcttcttattataatgtagatgtattaaaataccaggta
tcatcaaatggcattcagtccactcctctaaatcttgcaacctactggaaatgtagtgcc
agcaccacagatctgagagtggattataagtacaacccagaagctatggtcgctccgagt
gtgctttccaacatacaggtggtggttcccgtggatggaggtgtcacaaatatgcagtcc
cttcctcctgcaatatggaatgcagagcaaatgaaagctttttggaaattatctgggatt
tcggagaaatcagacagtggaggttctggatccctcagagcaaaatttgatctttcagaa
ggacccagcaaacctacaacactggcagtgcaattcctcagtgagggcaatacgctctca
ggagtggatattgagcttgtgggtactggctatagactttccttagtaaagaagcgcttt
gccactggacgatacttggcagattgttga

DBGET integrated database retrieval system