KEGG   Mus musculus (house mouse): 218518
Entry
218518            CDS       T01002                                 
Symbol
Marveld2, MARVD2, Mrvldc2, Tric, Trica, Tricb, Tricc
Name
(RefSeq) MARVEL (membrane-associating) domain containing 2
  KO
K17291  MARVEL domain-containing protein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    218518 (Marveld2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    218518 (Marveld2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   218518 (Marveld2)
SSDB
Motif
Pfam: Occludin_ELL MARVEL Gp-FAR-1 MAP17
Other DBs
NCBI-GeneID: 218518
NCBI-ProteinID: NP_001033691
MGI: 2446166
Ensembl: ENSMUSG00000021636
UniProt: Q3UZP0 A1BQX3
Position
13:complement(100732465..100753479)
AA seq 555 aa
MSSSDARSRIRDRGYSEVPRDTSCPDGTIRTFQSLHSSELAVSADPLPPPPLPLQPPFGP
SFYSSDTEEPAVAPDLKPVRRFVPDSWKNFFRGKKKDPEWDNPVSDIRYISDGVECSPPA
SPARANHHPYKDPSRGSQGTFNSQHEADAMFAHDPYASLDRRTQTARTYSEKVEEYNLRY
AYMKSWAGLLRILGVVELLLGAGVFACVTAYIHKDNEWYNLFGYTQPYGMGGLGSLGNTY
GGYYYSGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGVNVALFIL
YMAAAIVYVNDTNRGGLCYYPLFNTPMNAMFCRVEGGQIAAMIFLFVTMIVYLVSALVCL
KLWRHEAARRHREFLEQQEINDPSLSSKRKMCEAAISDRQRDQEVNVKDLRTTTKMTPEL
LSGHIPPGHIPKPIVMPDYVAKYPVIQTDDDRERYKAVFQDQFSEYKELSAEVQAILRKF
DELDTVMSRLPHHSENRQEHERISRIHEEFRKKKNDPSFLEKKERCDYLKNKLSHIKQRI
QEYDKVMNWDTQGYP
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgtcgtcaagtgacgcaaggtccaggattcgggacaggggctatagtgaggttcccagg
gacacgtcttgtccagatggtaccataagaaccttccagtctcttcacagcagtgagctg
gcagtgagcgcagatcctctgcctcctccccctctcccattacagccaccattcggcccc
agcttctactcaagtgacacagaggagccagcagtggcaccagacctcaagccggtaaga
cgctttgttcccgactcctggaaaaatttcttcagagggaagaaaaaggacccagaatgg
gataacccggtgtctgatatcagatacatctccgatggtgtggagtgttcacctccagcc
tctccagcaagggcaaaccaccacccttacaaagacccttccagagggtcgcaaggcacc
tttaattcccagcacgaggcagatgccatgtttgcccacgacccctatgcatccttagac
cggcgcacacagacggcgcggacgtattctgagaaggtagaggaatacaatctgcgctac
gcctacatgaagtcgtgggcaggcctgctgagaatcctgggtgtggtggaactgcttctg
ggggccggcgtcttcgcgtgtgtcacggcttacatccacaaggacaacgagtggtacaac
ttgtttggctatacacagccctatggcatgggaggtctcggcagcctcggcaatacatat
gggggttattactacagtggccccaagacccccttcgtactcgtggtggctggattggct
tggatcaccaccattattatcctggtgcttggcatgtccatgtattaccgcaccatcctt
ttggactctaactggtggcccctgactgagttcggagttaacgttgcgttgtttatcctg
tacatggctgcagccatagtctatgtgaacgataccaaccgaggtggactctgctactac
ccgttatttaatacaccaatgaatgcgatgttctgccgggtagaaggaggtcagatagct
gcaatgatcttcctgtttgtcaccatgatagtttatctcgtcagcgccctggtctgccta
aagctgtggaggcacgaagcggctcggagacatcgggagttcctggagcagcaggagata
aatgacccgtcgttgtcatcgaaaaggaaaatgtgtgaagcggccatcagtgatcgacag
agggatcaggaagttaatgtcaaagacttgagaacaacaactaaaatgactcctgagctg
ttgagtgggcacatccctcccggccacattccgaagcctatcgtgatgcctgactacgtg
gcaaaatatcctgtgattcagacagatgacgatcgagaacgctataaggctgtgttccaa
gaccagttttcagagtacaaagagctgtctgcggaagtgcaggccatcctgaggaagttt
gacgagctggacacagtgatgagcaggctcccacatcattctgaaaaccgccaggaacac
gagagaatttcaagaattcatgaagagtttaggaaaaagaagaatgacccttcgtttctg
gaaaaaaaggagcgttgcgattacctcaagaacaaactctctcacataaagcaaagaatt
caagaatacgataaagtgatgaattgggatacgcaaggttatccctag

DBGET integrated database retrieval system