KEGG   Mus musculus (mouse): 21855Help
Entry
21855             CDS       T01002                                 

Gene name
Timm17b, 17kDa, Sfc3, mTim17b
Definition
(RefSeq) translocase of inner mitochondrial membrane 17b
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    21855 (Timm17b)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    21855 (Timm17b)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    21855 (Timm17b)
Transporters [BR:mmu02000]
 Other transporters
  Primary active transporters [TC:3]
   21855 (Timm17b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tim17
Motif
Other DBs
NCBI-GeneID: 21855
NCBI-ProteinID: NP_035721
MGI: 1343176
Ensembl: ENSMUSG00000031158
Vega: OTTMUSG00000018003
UniProt: Q9Z0V7 Q545H3
Position
X A1.1; X 3.56 cM
AA seq 172 aa AA seqDB search
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAP
QIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARSGPLAMVGSAMMGG
ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLTPKEGSPAPGYPNYQQYH
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtacgctcgcgaaccttgcccatggcgaattgtggatgattgcggtggagct
ttcaccatgggtgtcattggtggtggagtcttccaggctatcaagggcttccgcaatgcc
cctgttggaattcgacaccggttcagaggtagtgtcaatgctgtgaggatccgggcaccc
cagattggaggaagctttgcagtgtggggaggtctgttctccaccatcgactgtggcctg
gtccggctacggggcaaagaagacccctggaattccatcagcagtggagcgttgactgga
gctgtgctggctgcgcgcagtggtccgctggccatggtgggctctgcgatgatgggaggc
atcctgttggccctcattgagggtgttggcatccttctcacccgctatactgcccagcag
ttccgaaatgcacccccattcttggaggaccccagccagctaaccccgaaagagggatct
ccggccccaggttatcccaactaccagcagtaccactga

DBGET integrated database retrieval system