KEGG   Mus musculus (mouse): 21857Help
Entry
21857             CDS       T01002                                 

Gene name
Timp1, Clgi, EPA, TIMP-1, TPA-S1, Timp
Definition
(RefSeq) tissue inhibitor of metalloproteinase 1
  KO
K16451  metalloproteinase inhibitor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    21857 (Timp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    21857 (Timp1)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I35: timp family
   21857 (Timp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP NTR DUF3906
Motif
Other DBs
NCBI-GeneID: 21857
NCBI-ProteinID: NP_001037849
MGI: 98752
Ensembl: ENSMUSG00000001131
Vega: OTTMUSG00000017184
UniProt: P12032
Position
X A1.3; X 16.38 cM
AA seq 205 aa AA seqDB search
MMAPFASLASGILLLLSLIASSKACSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQ
RYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHI
SACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSE
DYQSRHFACLPRNPGLCTWRSLGAR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatggccccctttgcatctctggcatctggcatcctcttgttgctatcactgatagct
tccagtaaggcctgtagctgtgccccaccccacccacagacagccttctgcaactcggac
ctggtcataagggctaaattcatgggttccccagaaatcaacgagaccaccttataccag
cgttataagatcaagatgactaagatgctaaaaggattcaaggctgtgggaaatgccgca
gatatccggtacgcctacaccccagtcatggaaagcctctgtggatatgcccacaagtcc
cagaaccgcagtgaagagtttctcatcacgggccgcctaaggaacggaaatttgcacatc
agtgcctgcagcttcttggttccctggcgtactctgagccctgctcagcaaagagctttc
tcaaagacctatagtgctggctgtggggtgtgcacagtgtttccctgtttatctatccct
tgcaaactggagagtgacactcactgtttgtggacggatcaggtcctcgtgggctctgag
gactaccagagccgtcactttgcttgcctgccacggaatccaggcttgtgcacctggaga
tcccttggggcccgatga

DBGET integrated database retrieval system