KEGG   Mus musculus (mouse): 21869Help
Entry
21869             CDS       T01002                                 

Gene name
Nkx2-1, AV026640, Nkx2.1, T/EBP, Titf1, Ttf-1
Definition
(RefSeq) NK2 homeobox 1
  KO
K09342  homeobox protein Nkx-2.1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21869 (Nkx2-1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    21869 (Nkx2-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 21869
NCBI-ProteinID: NP_033411
MGI: 108067
Ensembl: ENSMUSG00000001496
Vega: OTTMUSG00000044396
UniProt: P50220 Q6PFE0
Position
12 C1; 12 24.42 cM
AA seq 372 aa AA seqDB search
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGH
HGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDP
RFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRF
KQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGG
GGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQSHAQQQAQQQAQAAQA
AAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAGLQGQVSSLSHLNSSGSDYGA
MSCSTLLYGRTW
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgagtccaaagcacacgactccgttctcagtgtctgacatcttgagtcccctg
gaggaaagctacaagaaagtgggcatggagggcggcggcctcggggctccgctcgcagcg
tacagacagggccaggcggccccaccggccgcggccatgcagcagcacgccgtggggcac
cacggcgccgtcaccgccgcctaccacatgacggcggcgggggtgccccagctctcgcac
tccgccgtggggggctactgcaacggcaacctgggcaacatgagcgagctgccgccttac
caggacaccatgcggaacagcgcttcgggccccggatggtacggcgccaacccagacccg
cgcttccccgccatctcccgcttcatgggcccggcgagcggcatgaatatgagtggcatg
ggcggcctgggctcgctgggggacgtgagcaagaacatggccccgctgcccagtgcgccc
cgccggaagcgccgggtgctcttctcccaggcgcaggtgtacgagctcgagcgacgtttc
aagcaacagaagtacctgtcggcgccggagcgcgagcatctggccagcatgattcacctg
acacccacgcaggtcaagatctggttccagaaccaccgctacaagatgaagcgccaggct
aaggacaaggcggcgcagcaacaactgcagcaggacagcggcggcggcggaggcggcggt
ggcggtgcgggatgcccgcagcagcagcaagctcagcagcagtcgccgcgccgggtggcc
gtgccggtcctagtcaaagacggcaaaccctgccaggcgggcgcccctgccccgggagcc
gcaagcctgcaaagccacgcgcagcaacaagctcagcagcaggcgcaggcggcgcaagcg
gctgccgcggccatctcagtgggcagcggtggcgcgggtctaggagcacacccaggccac
cagccgggcagcgcagggcagtccccggacctggcgcaccacgcagccagccccgcgggg
ctgcagggccaggtctccagcctatcccatctgaactcctcgggctcggactatggcgcc
atgtcttgttctaccttgctttatggtcggacctggtga

DBGET integrated database retrieval system