KEGG   Mus musculus (house mouse): 218693
Entry
218693            CDS       T01002                                 
Symbol
Paip1, PAIP-1
Name
(RefSeq) polyadenylate binding protein-interacting protein 1
  KO
K14322  polyadenylate-binding protein-interacting protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    218693 (Paip1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     218693 (Paip1)
SSDB
Motif
Pfam: MIF4G PAM2
Other DBs
NCBI-GeneID: 218693
NCBI-ProteinID: NP_663432
MGI: 2384993
Ensembl: ENSMUSG00000025451
UniProt: Q8VE62
Position
13:119565136..119596859
AA seq 400 aa
MSDSFDRAPEQTKPQRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSANAPEFYPSG
YSSNYTESYEDGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGWVTTDDALQE
LVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEAKDQAAKG
DEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGLRELLNALFSNPMDDNLICA
VKLLKLTGSVLEDTWKEKGKTDMEEIIQRIENVVLDANCSRDVKQMLLKLVELRSSNWGR
VHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEEN
GTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgtcggacagtttcgatcgggctccagaacaaacgaagccccagagagctccacctagt
tcacaggataaaatcccacagcagaactcggagtcagcaatggctaagccccaggtggtt
gtggctcctgtgttaatgtctaagctgtctgcgaacgcccccgaattttacccatcaggt
tattcttctaattatacagaatcctatgaggatggttgtgaggattacccgactctctca
gaatacgttcaggattttctgaatcatctgacagaacagcctggtagttttgaaacagaa
attgaacagtttgcagaaaccctgaatggatgggtcacaacagatgatgctttgcaagaa
cttgtggaacttatctaccaacaggccacgtctatcccaaatttctcttacatgggagct
cgcctgtgtaattacctgtcccatcatctgacaattagtccacagagtggcaacttccgc
caattgctacttcaaaggtgcaggacggagtatgaagctaaagaccaagctgcaaaaggg
gatgaagtgactcgaaaacgatttcatgcatttgttctgtttctgggagaactatatctt
aacctggagattaaaggaacaaatggacaagttacaagagcagatattcttcaggttggt
cttcgggaactgctgaatgctctgttttctaatcctatggatgacaacttaatttgtgca
gtaaaattgctaaagttgacaggatcagttttagaagatacttggaaggaaaaggggaaa
actgatatggaagaaataattcagagaattgaaaatgttgtcctagatgcaaactgcagc
agagatgtaaaacagatgctcttgaagcttgttgaacttcgatcaagtaactggggtagg
gtccatgcaacttcaacatacagagaagctacccctgaaaatgaccctaattacttcatg
aatgaaccaacattttatacatctgatggtgttcctttcactgcagcggacccagattac
caagaaaagtatcaagagttacttgaaagagaggacttttttccagattatgaagaaaat
ggaacagatttatcaggggctggtgacccatatttggatgatatcgatgatgagatggac
ccagaaattgaagaagcttatgaaaagttttgtttggaatcagagcgcaagcgaaaacag
taa

DBGET integrated database retrieval system