KEGG   Mus musculus (house mouse): 218699
Entry
218699            CDS       T01002                                 
Symbol
Pxk, C230080L11Rik, D14Ertd813e, Monaka, Slob
Name
(RefSeq) PX domain containing serine/threonine kinase
  KO
K17543  PX domain-containing protein kinase-like protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    218699 (Pxk)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  Slob family
   218699 (Pxk)
SSDB
Motif
Pfam: PX Pkinase PK_Tyr_Ser-Thr WH2 Rrn6
Other DBs
NCBI-GeneID: 218699
NCBI-ProteinID: NP_663433
MGI: 1289230
Ensembl: ENSMUSG00000033885
UniProt: Q8BX57
Position
14:complement(14304656..14371593)
AA seq 582 aa
MAFMEKPPAGKVLLDDTVPLTAAVEASQSLQSHTEYIIRVQRGISAENSWQIVRRYSDFD
LLNNSLQITGLSLPLPPKKLIGNMDREFIAERQRGLQNYLNVIMANHVLSNCELLKKFLD
PNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSW
ADLGPDKYLSDKDFQCLIKLLPSCVHPYIYRVTFATASESSALLIRAFNEKGTLKDLIYK
AKPKDPFLKKYCNPKKTQGLELQQIKTYGRQILEALKFLHDKGFPYGHLHAANVMLDGNT
CRLLDLENSLLGLPSFYRSYFTQFRKINTLESVDVHCFGHLLYEMTYGRPPDSVPVDSFP
PASSLAVVAVLESTLSCEACKNGMPTVSRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR
IAKECIEKRLTEEQKQIHQHRRLTRAQSHHGSEEERKRRKILARKKSKRSAVENSEEQPV
KHSNSNNSAGSGASSPLTSPSSPTPPSTAGLSSALPPPPPPPPPPPPPAGPSPTSATEMP
APFLPQPVNGVNRGALLSSIQNFQKGTLRKAQTCDHSAPKIG
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggccttcatggagaagccgccggctggcaaggtgctgctggacgacacggtgccgctg
acagcggccgtcgaggcgagccagagtctgcagtcgcacacggaatatatcatccgggtg
caaagaggaatttctgcagaaaacagctggcagatcgtcagaagatacagtgacttcgat
ctgcttaacaacagcttgcaaattacaggcctgagcctgcctcttcctcctaagaaactg
attggaaacatggaccgtgagttcatcgctgagaggcagcgaggcctgcagaactacctt
aacgtcatcatggcaaatcatgtcttgtccaactgtgagctgcttaagaagttcctagac
ccaaacaactattctgcaaactatactgagatcgccttacagcaggtttccatgttcttc
cgatcagaaccaaagtgggaggtggtagaaccactgaaggacataggttggaggataagg
aagaaatatttcttgatgaaaataaaaaaccaaccaaaggagcggctggtgctaagctgg
gctgatcttggcccagacaagtacttgtcagataaagattttcagtgtctaatcaaactt
ctgccttcctgtgtgcacccttacatctatcgggtcacctttgccacggctagcgagtcc
tccgcattgctgattagagcctttaatgagaagggaactttgaaggatctgatctacaag
gcaaaaccaaaggaccccttcctaaagaaatactgcaaccctaagaaaacccagggcctt
gaactccagcaaataaaaacatatgggcggcagatattagaggcactaaagtttcttcat
gacaagggattcccttacggccacctccatgcagccaatgtgatgctggatggcaacact
tgccggctgctagacctcgaaaactcactgctgggtctgccttccttctaccgatcctac
ttcacacaattcaggaaaatcaatacattggagagtgtagatgtgcactgttttggccac
ttactctatgaaatgacttatggacgacctcccgactccgtgcctgtggactcctttcct
cctgcatcatccttggctgtggtggccgtattggagtctacgctgtcttgtgaagcctgt
aaaaatggcatgcctaccgtctcccggctcttacagatgccattattcagtgatgtttta
ctaacaacttctgaaaagccacagtttaagattcccacaaaactaaaagaggcattgcga
attgccaaggaatgcatagagaagagactcaccgaggaacagaagcagattcaccagcat
cgaagactaacgagagcccagtcacaccatgggtctgaggaagaaaggaaaaggagaaag
atcttagctcgaaagaagtcaaaacgatctgctgttgaaaacagtgaggagcagccagtg
aagcacagtaactccaataactcagcaggatctggggccagctcacctctcacatcccca
tcatctccaactccaccctccacagcaggactgtcttcagcattacctccacctcctccg
ccacctcctcctccacctccaccagcaggtccctcgccaacctcagccacggagatgcct
gctccgttcctgccccagcctgtgaatggtgtgaaccgtggggccttgctcagttccatc
cagaatttccaaaagggaactttgcggaaagcccaaacctgtgatcacagcgctcccaag
atcggctga

DBGET integrated database retrieval system