KEGG   Mus musculus (mouse): 21873
Entry
21873             CDS       T01002                                 

Symbol
Tjp2, ZO-, ZO-2
Name
(RefSeq) tight junction protein 2
  KO
K06098  tight junction protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    21873 (Tjp2)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1
Other DBs
NCBI-GeneID: 21873
NCBI-ProteinID: NP_035727
MGI: 1341872
Ensembl: ENSMUSG00000024812
UniProt: Q9Z0U1
Structure
PDB: 
2CSJ

Position
19; 19 B
AA seq 1167 aa
MEEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQEND
RVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQVAPLQGSPPLSHDDRGFEVI
EEFDGRSFRSGYSERSRHSSHDMLSHSWEGNRERGRPHQRTQSRERERSRGRSLERGLDQ
EDYGRSRERSRGRSLERGLDRDFVSRDHSRGRSIDRDYDRDYERSYHEAYEPDYGGGYSP
SYDRRAHPETRYERSRSREHLRSRSPSPESRSRHEHKGQHDPDRPIGVLLTKSKANEEYG
LRLGSQIFIKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLV
VLRDSKQTLINIPALNDSDSEVEDISEIESNRSFSPEERRQQYSDQDYHSSTEKLKERPS
SREETSGRLSRMGATPTPFKSTGDITAAGVTEASREPRYQEEGPVPQPRTAPRVFLRPSP
EDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNT
QDFRGLVREDAVLYLLEIPKGETVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETP
QSLAFTRGEVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRENAG
DRADFWRMRGQRSSGGVKKNLRKSREDLAAAVSVSTKFPAYEKVLLREAGFKRPVVLFGP
IADIAMERLATELPDLFQTAKTEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAV
DLLNYTQWFPIVIFFNPDSRQGVKTIRQRLSPTSNKSSRKLFDQANKLKKTCSHLFTATI
NVNSANDGWFGSLKDSIQQQQNEAVWVSEGKMEGMDDDAEDRMSYLTAMGADYLSCDSRL
ISDFEDTDGEGGAYTDNELEEPAEEPLVSSITRSSEPVQHEENIRKSSPEPRAQMRRAAS
RDQLRDASPPPAFKPEPPKARSQNREDSFDYSKSNLPATAGSEIPGGSTKGYPPPIAAKP
AFGRPILKPSTPVPMPESEEVGESTEEQEDAPRSVLGRVKIFEKMDHKAKLQRMQELQEA
QNARIEIAQKHPDIYAVPIKAPKPDAGLPPHMSSRPPEPQKAPSRLYQDTRGSYGSDPEE
EEYRQQLAAHSKRGYYSQPSRYRDTEL
NT seq 3504 nt   +upstreamnt  +downstreamnt
atggaggaggtgatatgggagcagtacaccgtgaccctgcagaaggattccaaaagagga
tttggaattgccgtgtcgggaggcagagacaacccccactttgaaaatggggagacgtca
atcgtcatctcagatgtgctcccaggtggacccgctgatggcttgcttcaagaaaatgac
agggtggtcatggtcaatggcacccccatggaagatgtgctccattcgtttgccgttcag
cagcttaggaaaagtgggaagatagcagccatcgtggtcaagagaccccggaaggttcag
gtggccccactgcaaggcagcccccctctcagtcatgacgaccgaggttttgaagtgatt
gaagaatttgatggcagaagtttccgcagcggctacagtgagaggagtcggcacagcagc
cacgacatgctcagccacagctgggagggcaatagggagagggggcgaccccatcagcgc
acacagagccgggagcgggagcgcagccgtggcaggagcctggaacggggcctggaccag
gaagactatgggcgcagccgtgagcgcagccgtggccggagcctggagcgcgggctggac
cgcgactttgtgtccagggaccacagccgtggccgtagcatcgacagggactacgaccga
gactatgagcgctcctatcacgaagcttatgaacccgactacggaggcggctacagccca
tcatatgaccgtagagcccatccagagacccgctatgaacggagccgcagccgagaacac
ctacgttcccgaagccccagccccgagtctaggtcacggcatgaacacaagggccaacat
gatcccgacaggcccatcggggtccttctaaccaaaagcaaagcaaatgaagagtatggg
ctccggctggggagtcagatcttcatcaaagaaatgaccagaacaggactggccaccaaa
gatggcaaccttcatgagggggacataattctcaagatcaacggcactgttactgagaac
atgtctctaacggatgctcggaagttaatagaaaagtctcgaggaaaactgcagcttgtg
gtgttgagagacagcaagcagaccctcatcaacatcccagccctaaacgacagcgactct
gaagtggaggatatctcggaaatagagtccaaccggtctttctctccagaggagagacgc
cagcagtattctgatcaggattaccattcctccactgagaagctgaaggagaggccgagc
tcaagagaggagacctcaggcagactatccaggatgggtgccactcccacgccgttcaag
tccacgggggacatcacagctgcgggggtcacagaggccagcagggagcccaggtaccag
gaagaaggcccagttcctcaacccagaacagctccaagagtttttcttcgtcctagtccc
gaagatgaagcaatatatggccctaacaccaaaatggtgaggttcaagaagggagacagc
gtgggcctccggttggctggtggaaacgacgttgggatatttgtggctggcattcaggag
ggcacctccgcagagcaggagggcctgcaagaaggagaccagattctgaaggtgaacaca
caggatttcagagggctagtccgggaagatgcggtcctctacctgctagaaatccccaaa
ggtgaaactgtgaccattttggctcagagccgagcagacgtgtacagagatatcctggct
tgtggcaggggagattcgtttttcataagaagccactttgaatgtgagaaggaaactccc
cagagcctggccttcaccaggggagaggtcttccgagtggtagacacgctgtacgatggc
aagctgggccactggctggccgtgaggatcgggaatgagctggagaaaggcttgatccct
aacaaaagcagagccgagcaaatggccagtgtccagaatgcccagcgagagaacgccggg
gacagagcagacttctggcggatgcgtggccagagatccagcggcggcgtcaagaagaac
ctccgcaagagccgggaagacctggcggctgctgtatcggttagcaccaagttccctgcc
tacgagaaggttctgcttcgggaagctggcttcaagagacccgtggttctgtttggcccc
atagcagatatagcaatggaaaggttggcaactgagttaccagacctgtttcaaactgca
aaaacagaacccaaagatgccggatctgagaaatccagtggagtggttcggttgaatacc
gtgaggcaaattattgagcaggacaagcacgccctgctcgacgttacccccaaagctgtg
gacctgctcaactacactcagtggttccctatcgtgattttcttcaacccggattccaga
caaggtgttaaaaccataaggcagaggttgagtccaacatccaataaaagttctcgcaag
ttatttgatcaagccaacaagctcaaaaagacctgttctcatctttttacagccacaatc
aacgtgaattcagccaacgatggctggtttggcagcttgaaggacagcattcagcagcag
caaaacgaagcagtctgggtctctgaaggaaagatggaagggatggatgatgatgctgaa
gaccgcatgtcctacttaaccgccatgggcgcggactatctgagttgtgacagccgtctc
atcagtgactttgaagacaccgacggcgagggaggcgcctacactgacaatgagctagag
gagccggcggaggagccgctggtgtcttccatcacccgctcctcggagccggtgcagcac
gaggagaacataaggaaatccagcccagagccacgagctcagatgaggagggctgctagc
agagaccaacttagggatgctagcccgcccccagccttcaagccagagccgcccaaggca
agaagccagaacagagaagactccttcgactactccaagtcaaacctccccgccacagcc
ggcagtgaaatcccggggggatccaccaaaggctatcctccccctattgcagcgaagcct
gcctttgggcggcccatcctgaagccttccactccagtccctatgcctgagagcgaggag
gttggagagagcaccgaggagcaggaagatgctcccagatcagtcctgggcagagtgaaa
atattcgagaagatggaccacaaggcaaaattacagaggatgcaggagctccaggaggcc
cagaatgcgaggatcgaaatagctcagaagcaccctgacatctatgcggttccaatcaag
gcccccaagccagatgctggcctccccccgcacatgagttctagacccccagagccccag
aaagctccttccagactttaccaggacaccagaggaagctacggcagtgaccccgaggag
gaggagtaccgccagcagttggcagcacactcgaagcgtggttactacagccagccctcc
cggtaccgagacacggagttatag

DBGET integrated database retrieval system